Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9S7E0

Protein Details
Accession C9S7E0    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
222-247APAPRPGKTPRKRKVKSERTRLPSLAHydrophilic
371-400GPESSERSSKRTKPNVQLKKERVRNRALLGHydrophilic
NLS Segment(s)
PositionSequence
182-240KKIAAPPKFEVKKAPQPQLAPPTPPRSMRLRRSASPTKSAAPAPRPGKTPRKRKVKSER
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037548  Bqt4  
IPR036887  HTH_APSES_sf  
IPR018004  KilA/APSES_HTH  
IPR003163  Tscrpt_reg_HTH_APSES-type  
Gene Ontology GO:1990862  C:nuclear membrane complex Bqt3-Bqt4  
GO:0003677  F:DNA binding  
GO:0048315  P:conidium formation  
GO:0070197  P:meiotic attachment of telomere to nuclear envelope  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG val:VDBG_01345  -  
PROSITE View protein in PROSITE  
PS51299  HTH_APSES  
Amino Acid Sequences MPAAATAPETITPSTERHLPTKQNPLMIDDIPPYQDLVSRRRLGQTQLTAKMVNQVDGDSTSLGVFDYAHLRAPVPKGIVSGIFKSSPNSYFLMRRSHDGYVSATGMFKATYPYAEAHEEETERRYIKSLPSTSPEETAGNVWIPPDHALSLAEEYGVLPWIQALLDPATIAMTQQPDSPPKKIAAPPKFEVKKAPQPQLAPPTPPRSMRLRRSASPTKSAAPAPRPGKTPRKRKVKSERTRLPSLAAETTTRTIEFEPAVVLQAQDEGQKVKVVVEQDVKIDEEGHEAKHPTVALELPLSSTEPPTAEETARMIAEAKSMVEAATATKTTDAADADGDVDVESEEKEPVELVKSKRKAEDITAAEEEEEGPESSERSSKRTKPNVQLKKERVRNRALLGISATLAVGAIVPFLMGVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.27
4 0.31
5 0.38
6 0.45
7 0.5
8 0.59
9 0.6
10 0.59
11 0.57
12 0.55
13 0.52
14 0.44
15 0.39
16 0.3
17 0.28
18 0.24
19 0.23
20 0.19
21 0.15
22 0.19
23 0.2
24 0.23
25 0.31
26 0.33
27 0.35
28 0.4
29 0.43
30 0.44
31 0.49
32 0.52
33 0.52
34 0.53
35 0.53
36 0.48
37 0.45
38 0.48
39 0.4
40 0.32
41 0.24
42 0.2
43 0.19
44 0.19
45 0.2
46 0.12
47 0.11
48 0.09
49 0.09
50 0.08
51 0.07
52 0.06
53 0.06
54 0.09
55 0.1
56 0.12
57 0.12
58 0.13
59 0.17
60 0.2
61 0.22
62 0.21
63 0.21
64 0.2
65 0.21
66 0.24
67 0.23
68 0.23
69 0.21
70 0.21
71 0.21
72 0.22
73 0.25
74 0.22
75 0.22
76 0.21
77 0.21
78 0.25
79 0.28
80 0.35
81 0.32
82 0.35
83 0.36
84 0.36
85 0.34
86 0.31
87 0.29
88 0.23
89 0.23
90 0.2
91 0.16
92 0.14
93 0.13
94 0.12
95 0.09
96 0.09
97 0.09
98 0.09
99 0.1
100 0.11
101 0.14
102 0.16
103 0.16
104 0.16
105 0.18
106 0.18
107 0.18
108 0.19
109 0.19
110 0.18
111 0.18
112 0.17
113 0.17
114 0.22
115 0.29
116 0.31
117 0.31
118 0.35
119 0.39
120 0.39
121 0.38
122 0.35
123 0.26
124 0.23
125 0.21
126 0.17
127 0.12
128 0.11
129 0.09
130 0.08
131 0.08
132 0.09
133 0.09
134 0.07
135 0.07
136 0.08
137 0.09
138 0.1
139 0.09
140 0.07
141 0.06
142 0.06
143 0.06
144 0.06
145 0.05
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.06
160 0.07
161 0.07
162 0.09
163 0.11
164 0.18
165 0.2
166 0.22
167 0.22
168 0.22
169 0.26
170 0.3
171 0.38
172 0.39
173 0.42
174 0.42
175 0.51
176 0.52
177 0.48
178 0.48
179 0.45
180 0.48
181 0.48
182 0.52
183 0.45
184 0.45
185 0.49
186 0.52
187 0.47
188 0.41
189 0.38
190 0.38
191 0.37
192 0.36
193 0.34
194 0.35
195 0.42
196 0.45
197 0.5
198 0.5
199 0.5
200 0.57
201 0.63
202 0.57
203 0.54
204 0.5
205 0.42
206 0.39
207 0.39
208 0.35
209 0.29
210 0.34
211 0.32
212 0.32
213 0.34
214 0.38
215 0.47
216 0.52
217 0.59
218 0.61
219 0.69
220 0.71
221 0.77
222 0.82
223 0.83
224 0.84
225 0.84
226 0.84
227 0.79
228 0.81
229 0.71
230 0.62
231 0.53
232 0.45
233 0.35
234 0.27
235 0.21
236 0.17
237 0.18
238 0.16
239 0.13
240 0.12
241 0.11
242 0.11
243 0.11
244 0.09
245 0.08
246 0.08
247 0.09
248 0.08
249 0.07
250 0.06
251 0.06
252 0.06
253 0.07
254 0.07
255 0.08
256 0.08
257 0.09
258 0.09
259 0.09
260 0.11
261 0.11
262 0.14
263 0.17
264 0.18
265 0.18
266 0.19
267 0.18
268 0.16
269 0.16
270 0.12
271 0.13
272 0.13
273 0.13
274 0.14
275 0.15
276 0.15
277 0.16
278 0.16
279 0.12
280 0.12
281 0.11
282 0.1
283 0.1
284 0.1
285 0.09
286 0.09
287 0.1
288 0.09
289 0.09
290 0.09
291 0.09
292 0.11
293 0.13
294 0.15
295 0.14
296 0.14
297 0.15
298 0.16
299 0.15
300 0.14
301 0.12
302 0.1
303 0.11
304 0.1
305 0.09
306 0.08
307 0.08
308 0.08
309 0.07
310 0.07
311 0.07
312 0.09
313 0.09
314 0.09
315 0.09
316 0.09
317 0.1
318 0.12
319 0.11
320 0.09
321 0.09
322 0.09
323 0.1
324 0.09
325 0.09
326 0.06
327 0.06
328 0.05
329 0.05
330 0.06
331 0.06
332 0.07
333 0.06
334 0.07
335 0.07
336 0.08
337 0.12
338 0.18
339 0.22
340 0.32
341 0.38
342 0.43
343 0.46
344 0.5
345 0.48
346 0.48
347 0.52
348 0.45
349 0.46
350 0.43
351 0.39
352 0.35
353 0.32
354 0.26
355 0.17
356 0.16
357 0.1
358 0.1
359 0.1
360 0.11
361 0.12
362 0.17
363 0.17
364 0.22
365 0.31
366 0.38
367 0.49
368 0.59
369 0.67
370 0.72
371 0.82
372 0.87
373 0.88
374 0.9
375 0.89
376 0.89
377 0.9
378 0.88
379 0.85
380 0.84
381 0.8
382 0.74
383 0.71
384 0.61
385 0.54
386 0.47
387 0.4
388 0.32
389 0.25
390 0.2
391 0.12
392 0.11
393 0.08
394 0.06
395 0.05
396 0.04
397 0.04
398 0.04