Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C9SKI7

Protein Details
Accession C9SKI7   
Localization Confidence High
Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-62GQVQSTPRPRGRPPKNKPIAQSGHydrophilic
71-93PAPESQPRRRGRPPGAKKQEPDTBasic
127-153INDETPKPGRQVRKRKRGRPSLAETAAHydrophilic
160-185EEEPPEPQKTQKRKRGRPPAEEKEQABasic
235-282PESQSQPKPKPKLKPKPRGRPRTSNISAAEPPQSPKPKNKSKAPRPSTHydrophilic
NLS Segment(s)
PositionSequence
48-56PRGRPPKNK
77-88PRRRGRPPGAKK
133-146KPGRQVRKRKRGRP
170-177QKRKRGRP
214-223AKKPRGRPRR
240-280QPKPKPKLKPKPRGRPRTSNISAAEPPQSPKPKNKSKAPRP
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR025212  CAD_CENP-Q  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG val:VDBG_05314  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
PF13094  CENP-Q  
Amino Acid Sequences MPPKAASRGRKRAALVASDASQPEPPALPQDVNEELSFEGQVQSTPRPRGRPPKNKPIAQSGLTPEPQSAPAPESQPRRRGRPPGAKKQEPDTGTQPSQTDGPAAATVTASQVHVTAEPSDGPQETINDETPKPGRQVRKRKRGRPSLAETAAETQPQQEEEPPEPQKTQKRKRGRPPAEEKEQAQGEPSEDRTQQPPPSTTAEASAIEADPPAKKPRGRPRRSDVSLPFDPPPPESQSQPKPKPKLKPKPRGRPRTSNISAAEPPQSPKPKNKSKAPRPSTDVPTTEPVPKKRRVTADSMTDVPAPPKPSMLFRHIGTKPASIPRARIEATWIPLPAPSIAIVTSLLHLAERPVLQRLATNTKRRDHAAFALRTVSHNLARKLARRFPFPPAASGAPGRTRAVGRAAARDADPRDEELDYERCIDAIRRLREDARKAHPLVPDERGKPAVVESRPADRTLHVADAPPQGLFQDIDMPGLEGIGARLGSHMESLRANLQPVEHVVPEIARSRAVLRAVLAQHLEPQQFQQVLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.52
3 0.46
4 0.42
5 0.39
6 0.37
7 0.31
8 0.27
9 0.23
10 0.2
11 0.17
12 0.16
13 0.18
14 0.2
15 0.2
16 0.2
17 0.25
18 0.26
19 0.27
20 0.26
21 0.22
22 0.2
23 0.2
24 0.19
25 0.14
26 0.12
27 0.09
28 0.11
29 0.13
30 0.2
31 0.26
32 0.34
33 0.39
34 0.44
35 0.53
36 0.62
37 0.71
38 0.75
39 0.77
40 0.81
41 0.85
42 0.85
43 0.81
44 0.8
45 0.76
46 0.67
47 0.63
48 0.57
49 0.54
50 0.49
51 0.45
52 0.36
53 0.31
54 0.3
55 0.26
56 0.22
57 0.17
58 0.19
59 0.23
60 0.29
61 0.37
62 0.42
63 0.5
64 0.54
65 0.6
66 0.65
67 0.71
68 0.75
69 0.77
70 0.79
71 0.82
72 0.86
73 0.86
74 0.81
75 0.77
76 0.75
77 0.65
78 0.6
79 0.53
80 0.51
81 0.44
82 0.44
83 0.37
84 0.31
85 0.3
86 0.25
87 0.21
88 0.13
89 0.14
90 0.11
91 0.11
92 0.1
93 0.09
94 0.09
95 0.09
96 0.09
97 0.08
98 0.07
99 0.08
100 0.08
101 0.09
102 0.1
103 0.09
104 0.1
105 0.1
106 0.11
107 0.12
108 0.12
109 0.12
110 0.12
111 0.12
112 0.13
113 0.15
114 0.17
115 0.19
116 0.18
117 0.22
118 0.23
119 0.25
120 0.27
121 0.31
122 0.38
123 0.46
124 0.57
125 0.64
126 0.72
127 0.8
128 0.85
129 0.9
130 0.9
131 0.89
132 0.87
133 0.84
134 0.83
135 0.76
136 0.67
137 0.58
138 0.51
139 0.42
140 0.33
141 0.25
142 0.16
143 0.14
144 0.14
145 0.14
146 0.13
147 0.16
148 0.18
149 0.25
150 0.27
151 0.29
152 0.29
153 0.35
154 0.42
155 0.49
156 0.57
157 0.59
158 0.68
159 0.75
160 0.85
161 0.9
162 0.89
163 0.89
164 0.89
165 0.88
166 0.85
167 0.8
168 0.7
169 0.65
170 0.56
171 0.45
172 0.36
173 0.28
174 0.21
175 0.19
176 0.2
177 0.18
178 0.17
179 0.19
180 0.2
181 0.24
182 0.26
183 0.28
184 0.26
185 0.26
186 0.29
187 0.29
188 0.27
189 0.24
190 0.23
191 0.2
192 0.18
193 0.16
194 0.11
195 0.1
196 0.09
197 0.09
198 0.08
199 0.1
200 0.14
201 0.18
202 0.2
203 0.29
204 0.4
205 0.51
206 0.56
207 0.62
208 0.66
209 0.72
210 0.73
211 0.73
212 0.66
213 0.63
214 0.58
215 0.53
216 0.46
217 0.38
218 0.35
219 0.29
220 0.27
221 0.24
222 0.23
223 0.22
224 0.28
225 0.34
226 0.44
227 0.51
228 0.57
229 0.6
230 0.65
231 0.73
232 0.77
233 0.79
234 0.8
235 0.82
236 0.84
237 0.88
238 0.92
239 0.93
240 0.89
241 0.88
242 0.82
243 0.81
244 0.73
245 0.68
246 0.59
247 0.52
248 0.45
249 0.36
250 0.34
251 0.24
252 0.23
253 0.24
254 0.28
255 0.26
256 0.34
257 0.41
258 0.48
259 0.55
260 0.63
261 0.67
262 0.72
263 0.81
264 0.78
265 0.75
266 0.72
267 0.71
268 0.67
269 0.61
270 0.52
271 0.43
272 0.4
273 0.37
274 0.37
275 0.35
276 0.36
277 0.38
278 0.43
279 0.45
280 0.47
281 0.52
282 0.49
283 0.52
284 0.49
285 0.49
286 0.45
287 0.43
288 0.38
289 0.32
290 0.28
291 0.22
292 0.2
293 0.16
294 0.13
295 0.13
296 0.13
297 0.17
298 0.21
299 0.25
300 0.25
301 0.24
302 0.33
303 0.32
304 0.35
305 0.32
306 0.3
307 0.28
308 0.3
309 0.34
310 0.25
311 0.27
312 0.25
313 0.28
314 0.27
315 0.24
316 0.25
317 0.24
318 0.26
319 0.25
320 0.23
321 0.18
322 0.18
323 0.19
324 0.13
325 0.1
326 0.08
327 0.07
328 0.07
329 0.07
330 0.07
331 0.06
332 0.07
333 0.06
334 0.06
335 0.05
336 0.05
337 0.05
338 0.07
339 0.08
340 0.09
341 0.11
342 0.11
343 0.12
344 0.14
345 0.18
346 0.26
347 0.32
348 0.4
349 0.43
350 0.47
351 0.5
352 0.51
353 0.5
354 0.44
355 0.45
356 0.45
357 0.41
358 0.37
359 0.38
360 0.35
361 0.33
362 0.32
363 0.26
364 0.23
365 0.27
366 0.27
367 0.3
368 0.33
369 0.38
370 0.42
371 0.48
372 0.47
373 0.48
374 0.5
375 0.51
376 0.57
377 0.51
378 0.47
379 0.43
380 0.41
381 0.36
382 0.35
383 0.3
384 0.24
385 0.26
386 0.24
387 0.22
388 0.21
389 0.2
390 0.23
391 0.25
392 0.24
393 0.26
394 0.27
395 0.27
396 0.27
397 0.3
398 0.28
399 0.26
400 0.26
401 0.22
402 0.23
403 0.22
404 0.21
405 0.21
406 0.22
407 0.19
408 0.2
409 0.18
410 0.16
411 0.16
412 0.18
413 0.21
414 0.27
415 0.32
416 0.33
417 0.36
418 0.43
419 0.5
420 0.56
421 0.55
422 0.54
423 0.57
424 0.56
425 0.58
426 0.56
427 0.52
428 0.5
429 0.49
430 0.49
431 0.43
432 0.43
433 0.4
434 0.36
435 0.32
436 0.32
437 0.33
438 0.26
439 0.3
440 0.29
441 0.35
442 0.36
443 0.37
444 0.34
445 0.27
446 0.3
447 0.27
448 0.28
449 0.22
450 0.22
451 0.25
452 0.29
453 0.28
454 0.24
455 0.21
456 0.17
457 0.18
458 0.16
459 0.12
460 0.14
461 0.14
462 0.15
463 0.15
464 0.15
465 0.13
466 0.13
467 0.12
468 0.06
469 0.06
470 0.06
471 0.06
472 0.05
473 0.06
474 0.07
475 0.08
476 0.1
477 0.11
478 0.11
479 0.12
480 0.15
481 0.19
482 0.2
483 0.21
484 0.2
485 0.2
486 0.2
487 0.23
488 0.24
489 0.2
490 0.19
491 0.18
492 0.17
493 0.2
494 0.21
495 0.18
496 0.15
497 0.16
498 0.18
499 0.22
500 0.23
501 0.21
502 0.19
503 0.25
504 0.26
505 0.29
506 0.28
507 0.24
508 0.28
509 0.32
510 0.32
511 0.26
512 0.27
513 0.31
514 0.29