Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C9SVJ2

Protein Details
Accession C9SVJ2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
125-149VTSLPPPHRRRCHCRIPTCRDVPPNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009286  Ins_P5_2-kin  
Gene Ontology GO:0005524  F:ATP binding  
GO:0035299  F:inositol pentakisphosphate 2-kinase activity  
GO:0016310  P:phosphorylation  
KEGG val:VDBG_08917  -  
Pfam View protein in Pfam  
PF06090  Ins_P5_2-kin  
Amino Acid Sequences MSNTQRPPGLPRLGDKWLEFVGEGAANTVWALHFIDDNGGDAYTQDLRQLCDGFLLRIQKHTKGGDSAISAADQLAYVQETILPAFNNDASLIVRQKLIQVTQPLIDECNAPPRRPWTTTASRAVTSLPPPHRRRCHCRIPTCRDVPPNSSAPASAPRVPTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.38
4 0.31
5 0.29
6 0.25
7 0.19
8 0.16
9 0.13
10 0.12
11 0.1
12 0.09
13 0.08
14 0.08
15 0.08
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.08
23 0.08
24 0.09
25 0.09
26 0.08
27 0.07
28 0.07
29 0.09
30 0.09
31 0.09
32 0.11
33 0.11
34 0.12
35 0.14
36 0.15
37 0.13
38 0.14
39 0.15
40 0.13
41 0.15
42 0.19
43 0.18
44 0.23
45 0.26
46 0.25
47 0.29
48 0.29
49 0.28
50 0.24
51 0.25
52 0.2
53 0.18
54 0.17
55 0.13
56 0.12
57 0.1
58 0.08
59 0.07
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.08
81 0.09
82 0.09
83 0.11
84 0.12
85 0.12
86 0.14
87 0.15
88 0.16
89 0.17
90 0.18
91 0.16
92 0.15
93 0.15
94 0.12
95 0.11
96 0.2
97 0.2
98 0.2
99 0.22
100 0.27
101 0.32
102 0.33
103 0.37
104 0.35
105 0.42
106 0.48
107 0.53
108 0.5
109 0.45
110 0.43
111 0.41
112 0.36
113 0.32
114 0.33
115 0.34
116 0.41
117 0.47
118 0.57
119 0.65
120 0.71
121 0.76
122 0.77
123 0.8
124 0.8
125 0.85
126 0.85
127 0.85
128 0.86
129 0.83
130 0.81
131 0.78
132 0.72
133 0.66
134 0.61
135 0.56
136 0.48
137 0.43
138 0.36
139 0.3
140 0.33
141 0.33
142 0.33