Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1Q8R1

Protein Details
Accession W1Q8R1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRSSNGRNKKGRGHVKPVRCVNCHydrophilic
83-111IVRVRSRTDRRIRTPPVRQRFNRERRVSPHydrophilic
NLS Segment(s)
PositionSequence
3-17KKRSSNGRNKKGRGH
92-108RRIRTPPVRQRFNRERR
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG opa:HPODL_01290  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRSSNGRNKKGRGHVKPVRCVNCSRCVPKDKAIKRVTIRNMVEAAAVRDLSEASVYDEYPLPKLYHKLAYCVSCAIHARIVRVRSRTDRRIRTPPVRQRFNRERRVSPADAAKKATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.82
4 0.8
5 0.79
6 0.82
7 0.82
8 0.78
9 0.7
10 0.69
11 0.63
12 0.64
13 0.62
14 0.59
15 0.56
16 0.57
17 0.58
18 0.6
19 0.65
20 0.61
21 0.64
22 0.61
23 0.61
24 0.59
25 0.63
26 0.6
27 0.59
28 0.54
29 0.46
30 0.44
31 0.36
32 0.33
33 0.25
34 0.2
35 0.12
36 0.11
37 0.08
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.09
49 0.1
50 0.11
51 0.09
52 0.1
53 0.12
54 0.14
55 0.19
56 0.19
57 0.22
58 0.24
59 0.25
60 0.25
61 0.24
62 0.21
63 0.17
64 0.18
65 0.16
66 0.17
67 0.16
68 0.19
69 0.22
70 0.26
71 0.28
72 0.29
73 0.34
74 0.39
75 0.47
76 0.54
77 0.59
78 0.65
79 0.68
80 0.75
81 0.79
82 0.79
83 0.81
84 0.82
85 0.83
86 0.84
87 0.81
88 0.81
89 0.84
90 0.84
91 0.84
92 0.81
93 0.76
94 0.74
95 0.78
96 0.7
97 0.65
98 0.65
99 0.62
100 0.59