Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QH62

Protein Details
Accession W1QH62    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-31KPAANSLKQVEKKKREVFKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.833, mito_nucl 10.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029064  L30e-like  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
KEGG opa:HPODL_00348  -  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MNNQDKVQKPNKPAANSLKQVEKKKREVFKAVLASPYSRRSLWPAVGAKLQNDLVDLLCSMLEQIGTFNKLSQAEKKSSGLEKPSISEYVIYGFNSCMKALEEQSKKIQSMKLVLNSDHTLRYLFVCKLDMTTPLLFQHFPILSAYANVKLIQLPKNTHQKLQKVLGLKKPTEVLVLAKGAAKMYPLLAELAEGVEDVDIEFLRSGPFEAKIKHILTQQTVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.66
4 0.64
5 0.65
6 0.64
7 0.7
8 0.72
9 0.71
10 0.71
11 0.75
12 0.8
13 0.77
14 0.78
15 0.73
16 0.71
17 0.7
18 0.61
19 0.56
20 0.49
21 0.45
22 0.41
23 0.4
24 0.34
25 0.27
26 0.27
27 0.29
28 0.32
29 0.32
30 0.35
31 0.35
32 0.34
33 0.39
34 0.39
35 0.33
36 0.31
37 0.29
38 0.21
39 0.19
40 0.17
41 0.12
42 0.11
43 0.1
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.04
51 0.05
52 0.06
53 0.08
54 0.09
55 0.09
56 0.12
57 0.14
58 0.16
59 0.21
60 0.24
61 0.26
62 0.29
63 0.3
64 0.31
65 0.32
66 0.33
67 0.3
68 0.29
69 0.26
70 0.25
71 0.25
72 0.23
73 0.2
74 0.17
75 0.14
76 0.12
77 0.12
78 0.11
79 0.09
80 0.08
81 0.1
82 0.11
83 0.1
84 0.09
85 0.09
86 0.1
87 0.12
88 0.2
89 0.2
90 0.22
91 0.26
92 0.28
93 0.27
94 0.28
95 0.27
96 0.2
97 0.23
98 0.24
99 0.25
100 0.24
101 0.24
102 0.24
103 0.24
104 0.23
105 0.19
106 0.16
107 0.12
108 0.1
109 0.12
110 0.12
111 0.11
112 0.11
113 0.12
114 0.11
115 0.12
116 0.13
117 0.13
118 0.13
119 0.13
120 0.13
121 0.13
122 0.14
123 0.13
124 0.12
125 0.16
126 0.12
127 0.12
128 0.12
129 0.12
130 0.11
131 0.12
132 0.13
133 0.09
134 0.1
135 0.1
136 0.1
137 0.11
138 0.15
139 0.18
140 0.21
141 0.23
142 0.3
143 0.4
144 0.42
145 0.46
146 0.49
147 0.5
148 0.52
149 0.54
150 0.51
151 0.48
152 0.52
153 0.54
154 0.54
155 0.49
156 0.45
157 0.41
158 0.38
159 0.32
160 0.27
161 0.2
162 0.17
163 0.17
164 0.16
165 0.16
166 0.15
167 0.14
168 0.13
169 0.12
170 0.09
171 0.09
172 0.09
173 0.08
174 0.08
175 0.08
176 0.08
177 0.07
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.05
186 0.04
187 0.05
188 0.06
189 0.06
190 0.07
191 0.07
192 0.09
193 0.1
194 0.14
195 0.17
196 0.19
197 0.24
198 0.3
199 0.32
200 0.34
201 0.38
202 0.4
203 0.42