Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QET3

Protein Details
Accession W1QET3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
120-169DLGDKSKTSEKKCKKDRKERKHKEKKDKHKSKKKSKVKDGKIKKKHKSKTBasic
NLS Segment(s)
PositionSequence
128-169SEKKCKKDRKERKHKEKKDKHKSKKKSKVKDGKIKKKHKSKT
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
KEGG opa:HPODL_03408  -  
Amino Acid Sequences MDPRGYLKSYGWIEGEALQQGGLKRPILVTHKKNTFGIGHTSNQAEAWWEKMFDGQLKSLDVTSNNGAVSFVQDAQSLKEFAKSQSPLYRMFVKGGLLQGTIKKEPEIDRTGSEELMIFDLGDKSKTSEKKCKKDRKERKHKEKKDKHKSKKKSKVKDGKIKKKHKSKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.17
4 0.15
5 0.12
6 0.14
7 0.14
8 0.18
9 0.18
10 0.17
11 0.16
12 0.17
13 0.23
14 0.28
15 0.37
16 0.38
17 0.45
18 0.51
19 0.53
20 0.53
21 0.51
22 0.46
23 0.39
24 0.39
25 0.33
26 0.29
27 0.28
28 0.28
29 0.25
30 0.23
31 0.2
32 0.16
33 0.12
34 0.13
35 0.12
36 0.11
37 0.11
38 0.12
39 0.14
40 0.14
41 0.16
42 0.14
43 0.15
44 0.15
45 0.15
46 0.15
47 0.14
48 0.12
49 0.13
50 0.12
51 0.12
52 0.11
53 0.11
54 0.1
55 0.09
56 0.1
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.09
66 0.12
67 0.12
68 0.12
69 0.18
70 0.17
71 0.19
72 0.23
73 0.25
74 0.23
75 0.25
76 0.28
77 0.23
78 0.23
79 0.21
80 0.17
81 0.17
82 0.16
83 0.14
84 0.11
85 0.11
86 0.12
87 0.15
88 0.15
89 0.14
90 0.13
91 0.15
92 0.17
93 0.22
94 0.23
95 0.22
96 0.22
97 0.26
98 0.26
99 0.24
100 0.21
101 0.16
102 0.13
103 0.12
104 0.11
105 0.07
106 0.06
107 0.08
108 0.08
109 0.08
110 0.08
111 0.1
112 0.17
113 0.23
114 0.3
115 0.4
116 0.5
117 0.59
118 0.7
119 0.79
120 0.83
121 0.88
122 0.93
123 0.93
124 0.95
125 0.96
126 0.96
127 0.97
128 0.97
129 0.97
130 0.96
131 0.96
132 0.96
133 0.96
134 0.96
135 0.96
136 0.96
137 0.96
138 0.96
139 0.96
140 0.95
141 0.95
142 0.95
143 0.95
144 0.95
145 0.95
146 0.95
147 0.95
148 0.95
149 0.94