Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QLB8

Protein Details
Accession W1QLB8   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
106-133SVEKSNGKERARKRKKNNLSELLKNKQPHydrophilic
NLS Segment(s)
PositionSequence
108-123EKSNGKERARKRKKNN
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG opa:HPODL_05085  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MADKAVYQYNLVHAAKDGRLRRQLRRRFLATCDRHNLMLPEAVGEDGYIFCPRCEDVLLSGVNLQIRVRYESKDGVRKRTLCYRCLGCKHEMTKDVLVQEKEAGKSVEKSNGKERARKRKKNNLSELLKNKQPKQAKTLDLMDFMKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.33
4 0.34
5 0.34
6 0.43
7 0.49
8 0.57
9 0.64
10 0.71
11 0.73
12 0.77
13 0.74
14 0.68
15 0.7
16 0.7
17 0.66
18 0.64
19 0.61
20 0.54
21 0.49
22 0.47
23 0.42
24 0.32
25 0.28
26 0.2
27 0.15
28 0.13
29 0.12
30 0.1
31 0.08
32 0.07
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.08
39 0.09
40 0.09
41 0.1
42 0.1
43 0.09
44 0.12
45 0.12
46 0.11
47 0.12
48 0.12
49 0.11
50 0.1
51 0.09
52 0.07
53 0.08
54 0.12
55 0.12
56 0.13
57 0.15
58 0.19
59 0.23
60 0.31
61 0.32
62 0.35
63 0.39
64 0.4
65 0.41
66 0.46
67 0.46
68 0.39
69 0.42
70 0.41
71 0.42
72 0.46
73 0.46
74 0.4
75 0.43
76 0.43
77 0.43
78 0.4
79 0.37
80 0.34
81 0.32
82 0.31
83 0.3
84 0.27
85 0.23
86 0.23
87 0.22
88 0.2
89 0.2
90 0.19
91 0.15
92 0.19
93 0.21
94 0.27
95 0.27
96 0.3
97 0.37
98 0.45
99 0.48
100 0.52
101 0.6
102 0.63
103 0.71
104 0.78
105 0.8
106 0.82
107 0.89
108 0.91
109 0.92
110 0.91
111 0.87
112 0.87
113 0.85
114 0.8
115 0.76
116 0.73
117 0.67
118 0.66
119 0.67
120 0.62
121 0.61
122 0.63
123 0.6
124 0.59
125 0.61
126 0.55
127 0.52