Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QFR0

Protein Details
Accession W1QFR0    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-25AHSARSKSKLRAKKEKISKKGSDYHydrophilic
65-90TSGWRSSRNSLYKKNHTRKKNKSIKFHydrophilic
NLS Segment(s)
PositionSequence
6-22RSKSKLRAKKEKISKKG
78-87KNHTRKKNKS
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG opa:HPODL_03724  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAHSARSKSKLRAKKEKISKKGSDYAKTNEERKERLAQKLQENLLKQKQEGTDAPVMEVDKKVSTSGWRSSRNSLYKKNHTRKKNKSIKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.86
4 0.85
5 0.86
6 0.82
7 0.78
8 0.78
9 0.74
10 0.69
11 0.64
12 0.59
13 0.58
14 0.56
15 0.53
16 0.52
17 0.49
18 0.45
19 0.44
20 0.48
21 0.44
22 0.47
23 0.5
24 0.48
25 0.5
26 0.53
27 0.52
28 0.46
29 0.44
30 0.42
31 0.39
32 0.35
33 0.3
34 0.27
35 0.25
36 0.25
37 0.24
38 0.23
39 0.22
40 0.21
41 0.21
42 0.18
43 0.18
44 0.16
45 0.15
46 0.12
47 0.09
48 0.1
49 0.1
50 0.1
51 0.13
52 0.17
53 0.25
54 0.31
55 0.37
56 0.41
57 0.47
58 0.55
59 0.6
60 0.63
61 0.65
62 0.67
63 0.71
64 0.79
65 0.84
66 0.84
67 0.86
68 0.89
69 0.9
70 0.92