Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QE85

Protein Details
Accession W1QE85   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
251-290LSAEEKKRLKQLKKQEKQEKLRQRTEEKRRKAQEEFKILTHydrophilic
NLS Segment(s)
PositionSequence
255-281EKKRLKQLKKQEKQEKLRQRTEEKRRK
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR029427  AIM23  
KEGG opa:HPODL_03625  -  
Pfam View protein in Pfam  
PF14877  mIF3  
Amino Acid Sequences MLRLLTRQFSALRSCSAESQRDGVRLRSLGGTAKDQDTLKLVFEKSREVNPKGLVKIIRKGENLGVMSLRTALAQIDLSKEGFLFMGSVRDQKFGDVGLLKVASPQKARRQLTKHLQQQKTQQFQQENPRLIAKQQKQENRQKEPDVKMVRVSWQITPHDLTSQKRHEVETQVKKGERVRIVIDDKDNFDADVRVAGDERSLTELEATKRGKIENFLDQLLEELGVEFHKEGAIYDKVSYDVKPQERKNELSAEEKKRLKQLKKQEKQEKLRQRTEEKRRKAQEEFKILTVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.39
4 0.41
5 0.37
6 0.39
7 0.39
8 0.42
9 0.42
10 0.38
11 0.37
12 0.33
13 0.32
14 0.29
15 0.27
16 0.26
17 0.27
18 0.28
19 0.26
20 0.27
21 0.29
22 0.28
23 0.27
24 0.25
25 0.24
26 0.21
27 0.22
28 0.22
29 0.21
30 0.22
31 0.28
32 0.27
33 0.35
34 0.41
35 0.39
36 0.43
37 0.45
38 0.5
39 0.45
40 0.47
41 0.44
42 0.41
43 0.46
44 0.47
45 0.48
46 0.43
47 0.44
48 0.41
49 0.41
50 0.38
51 0.31
52 0.25
53 0.19
54 0.18
55 0.16
56 0.13
57 0.08
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.09
64 0.1
65 0.1
66 0.1
67 0.1
68 0.09
69 0.08
70 0.08
71 0.06
72 0.05
73 0.08
74 0.09
75 0.13
76 0.14
77 0.16
78 0.16
79 0.16
80 0.16
81 0.13
82 0.15
83 0.11
84 0.1
85 0.1
86 0.1
87 0.1
88 0.13
89 0.15
90 0.15
91 0.18
92 0.24
93 0.31
94 0.4
95 0.43
96 0.47
97 0.51
98 0.57
99 0.64
100 0.68
101 0.69
102 0.7
103 0.71
104 0.67
105 0.72
106 0.71
107 0.68
108 0.61
109 0.58
110 0.5
111 0.51
112 0.57
113 0.55
114 0.48
115 0.42
116 0.41
117 0.35
118 0.35
119 0.39
120 0.34
121 0.34
122 0.39
123 0.45
124 0.52
125 0.61
126 0.67
127 0.65
128 0.65
129 0.62
130 0.63
131 0.58
132 0.58
133 0.52
134 0.45
135 0.39
136 0.35
137 0.32
138 0.29
139 0.27
140 0.2
141 0.21
142 0.21
143 0.21
144 0.22
145 0.19
146 0.2
147 0.22
148 0.22
149 0.25
150 0.29
151 0.31
152 0.31
153 0.32
154 0.32
155 0.35
156 0.42
157 0.45
158 0.45
159 0.46
160 0.45
161 0.46
162 0.47
163 0.47
164 0.4
165 0.33
166 0.3
167 0.32
168 0.34
169 0.34
170 0.34
171 0.29
172 0.28
173 0.27
174 0.25
175 0.19
176 0.17
177 0.14
178 0.1
179 0.1
180 0.09
181 0.08
182 0.08
183 0.08
184 0.08
185 0.07
186 0.08
187 0.09
188 0.08
189 0.08
190 0.09
191 0.13
192 0.14
193 0.21
194 0.22
195 0.21
196 0.22
197 0.24
198 0.24
199 0.25
200 0.27
201 0.28
202 0.29
203 0.28
204 0.27
205 0.25
206 0.24
207 0.2
208 0.16
209 0.08
210 0.05
211 0.05
212 0.05
213 0.06
214 0.05
215 0.05
216 0.06
217 0.06
218 0.06
219 0.1
220 0.12
221 0.13
222 0.14
223 0.14
224 0.16
225 0.17
226 0.17
227 0.18
228 0.25
229 0.32
230 0.4
231 0.43
232 0.52
233 0.56
234 0.59
235 0.58
236 0.56
237 0.51
238 0.52
239 0.57
240 0.55
241 0.58
242 0.6
243 0.59
244 0.62
245 0.68
246 0.67
247 0.67
248 0.71
249 0.74
250 0.79
251 0.86
252 0.88
253 0.89
254 0.9
255 0.91
256 0.91
257 0.9
258 0.89
259 0.86
260 0.86
261 0.86
262 0.88
263 0.87
264 0.86
265 0.87
266 0.87
267 0.86
268 0.85
269 0.84
270 0.83
271 0.83
272 0.77