Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1QBS6

Protein Details
Accession W1QBS6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-108FRAFRECKKEWMKERRKDGGIBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
KEGG opa:HPODL_04099  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPNENVDNKTLRRLETQTDDKPSFVEKIDNEIKVKFYPDSPTQRVHKDAFLTKTASKFYDPCAKSSQMAIRCMENHDEDYKEVCGEYFRAFRECKKEWMKERRKDGGIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.5
4 0.48
5 0.53
6 0.52
7 0.46
8 0.44
9 0.4
10 0.33
11 0.26
12 0.25
13 0.17
14 0.24
15 0.29
16 0.3
17 0.29
18 0.28
19 0.29
20 0.25
21 0.27
22 0.2
23 0.17
24 0.2
25 0.25
26 0.33
27 0.34
28 0.39
29 0.4
30 0.42
31 0.45
32 0.41
33 0.36
34 0.31
35 0.33
36 0.3
37 0.28
38 0.28
39 0.25
40 0.26
41 0.24
42 0.22
43 0.19
44 0.16
45 0.18
46 0.25
47 0.24
48 0.25
49 0.28
50 0.28
51 0.27
52 0.3
53 0.33
54 0.27
55 0.3
56 0.28
57 0.26
58 0.26
59 0.27
60 0.27
61 0.22
62 0.21
63 0.2
64 0.2
65 0.19
66 0.2
67 0.18
68 0.16
69 0.14
70 0.12
71 0.11
72 0.11
73 0.14
74 0.15
75 0.17
76 0.21
77 0.23
78 0.29
79 0.36
80 0.38
81 0.44
82 0.5
83 0.57
84 0.63
85 0.73
86 0.78
87 0.79
88 0.85
89 0.84