Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QJC9

Protein Details
Accession W1QJC9   
Localization Confidence High
Confidence Score 19
NoLS Segment(s)
PositionSequenceProtein Nature
58-77LAAPKKKTSHMKRRLRLYTPHydrophilic
144-163ERPHVKKLRLKEYVEKRPKPBasic
NLS Segment(s)
PositionSequence
63-64KK
69-70KR
159-162KRPK
Subcellular Location(s) nucl 14, mito 8, extr 2, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG opa:HPODL_05092  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSLAIAHPLAGLAARLALPAVPALSNALWAPAESFLDRLRNKLPSKLLPSFLDNGLVLAAPKKKTSHMKRRLRLYTPGSKQIKPNHNLNRCPSCGNYKRSHFLCMSCFFEIKQLWSEQAGKPPVYKEEFANPADERVLYPKTYERPHVKKLRLKEYVEKRPKPLPVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.06
7 0.07
8 0.06
9 0.06
10 0.08
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.1
18 0.08
19 0.1
20 0.09
21 0.11
22 0.11
23 0.2
24 0.2
25 0.22
26 0.25
27 0.31
28 0.33
29 0.38
30 0.42
31 0.4
32 0.48
33 0.48
34 0.48
35 0.42
36 0.43
37 0.4
38 0.34
39 0.29
40 0.21
41 0.17
42 0.13
43 0.11
44 0.08
45 0.09
46 0.12
47 0.12
48 0.13
49 0.14
50 0.2
51 0.3
52 0.4
53 0.49
54 0.56
55 0.65
56 0.71
57 0.79
58 0.81
59 0.74
60 0.72
61 0.67
62 0.66
63 0.59
64 0.62
65 0.57
66 0.52
67 0.53
68 0.54
69 0.56
70 0.49
71 0.55
72 0.55
73 0.58
74 0.6
75 0.61
76 0.58
77 0.5
78 0.49
79 0.42
80 0.42
81 0.42
82 0.43
83 0.44
84 0.43
85 0.48
86 0.48
87 0.5
88 0.42
89 0.37
90 0.36
91 0.32
92 0.32
93 0.27
94 0.26
95 0.22
96 0.25
97 0.23
98 0.2
99 0.19
100 0.16
101 0.16
102 0.18
103 0.21
104 0.18
105 0.24
106 0.26
107 0.24
108 0.25
109 0.26
110 0.29
111 0.29
112 0.29
113 0.24
114 0.28
115 0.32
116 0.31
117 0.33
118 0.28
119 0.26
120 0.25
121 0.23
122 0.17
123 0.17
124 0.19
125 0.15
126 0.17
127 0.22
128 0.27
129 0.31
130 0.39
131 0.45
132 0.5
133 0.6
134 0.68
135 0.71
136 0.72
137 0.77
138 0.79
139 0.77
140 0.75
141 0.75
142 0.76
143 0.78
144 0.82
145 0.78
146 0.74
147 0.73
148 0.74