Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QEY2

Protein Details
Accession W1QEY2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
281-302DTWLAKKTKTIKKEKSLYRFSEHydrophilic
NLS Segment(s)
PositionSequence
353-356KKLK
Subcellular Location(s) E.R. 7, extr 6, golg 5, cyto 3, plas 3, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR037654  Big1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
KEGG opa:HPODL_01015  -  
Amino Acid Sequences MRTSVVIVQLVWAALCLAKNTFPALIASSKLIPGLRPALPHSEQLPFDLGEATSTIYRVLEQCTSDAYILINLPGLRVDDFHHFERFRHLREQLSQASTVVTFPNVLVDDEKLAMDDFVRFLRIHCNTLTYDVVKEDAAEVPKYLDTRTRTINVQLGGLSDEMSKTERLEKLDEYNELLREIMRKLPTPRYTILFSTNTTTPYEEKEYKVIYPEDVPEDPKDLTVRDRCLAKTASNMIFPDITVFDKTRYLEIERNKHGERDDYSSHPDGLWAKDLLEEDDTWLAKKTKTIKKEKSLYRFSEDQSESPAVFDREFLIDNGPVIVGGLFVVVTLFALDILRGIARQVAGLIRGKKLKRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.12
6 0.13
7 0.15
8 0.15
9 0.14
10 0.15
11 0.16
12 0.16
13 0.16
14 0.17
15 0.17
16 0.17
17 0.18
18 0.17
19 0.15
20 0.18
21 0.22
22 0.21
23 0.22
24 0.25
25 0.3
26 0.32
27 0.34
28 0.32
29 0.32
30 0.31
31 0.31
32 0.3
33 0.23
34 0.21
35 0.2
36 0.17
37 0.12
38 0.12
39 0.11
40 0.09
41 0.09
42 0.09
43 0.08
44 0.09
45 0.1
46 0.13
47 0.14
48 0.15
49 0.15
50 0.17
51 0.18
52 0.17
53 0.16
54 0.13
55 0.12
56 0.11
57 0.1
58 0.11
59 0.09
60 0.09
61 0.09
62 0.1
63 0.09
64 0.09
65 0.12
66 0.16
67 0.2
68 0.23
69 0.28
70 0.28
71 0.28
72 0.38
73 0.41
74 0.38
75 0.41
76 0.41
77 0.4
78 0.44
79 0.5
80 0.45
81 0.43
82 0.39
83 0.32
84 0.3
85 0.25
86 0.22
87 0.15
88 0.1
89 0.08
90 0.07
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.1
97 0.1
98 0.1
99 0.08
100 0.07
101 0.07
102 0.06
103 0.06
104 0.06
105 0.06
106 0.08
107 0.08
108 0.09
109 0.17
110 0.19
111 0.2
112 0.2
113 0.22
114 0.21
115 0.24
116 0.25
117 0.17
118 0.16
119 0.14
120 0.15
121 0.12
122 0.11
123 0.09
124 0.1
125 0.11
126 0.1
127 0.1
128 0.1
129 0.11
130 0.12
131 0.11
132 0.14
133 0.16
134 0.18
135 0.22
136 0.23
137 0.23
138 0.25
139 0.28
140 0.23
141 0.2
142 0.18
143 0.15
144 0.13
145 0.12
146 0.1
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.07
153 0.11
154 0.13
155 0.15
156 0.17
157 0.18
158 0.2
159 0.22
160 0.22
161 0.19
162 0.19
163 0.17
164 0.15
165 0.14
166 0.11
167 0.1
168 0.11
169 0.13
170 0.12
171 0.15
172 0.19
173 0.27
174 0.3
175 0.32
176 0.33
177 0.32
178 0.33
179 0.31
180 0.32
181 0.26
182 0.23
183 0.23
184 0.22
185 0.2
186 0.19
187 0.19
188 0.15
189 0.16
190 0.21
191 0.2
192 0.2
193 0.22
194 0.22
195 0.22
196 0.24
197 0.21
198 0.17
199 0.16
200 0.16
201 0.17
202 0.16
203 0.18
204 0.15
205 0.17
206 0.16
207 0.15
208 0.15
209 0.12
210 0.17
211 0.2
212 0.22
213 0.23
214 0.25
215 0.25
216 0.28
217 0.29
218 0.24
219 0.24
220 0.27
221 0.26
222 0.26
223 0.26
224 0.23
225 0.21
226 0.2
227 0.17
228 0.12
229 0.11
230 0.11
231 0.12
232 0.12
233 0.14
234 0.15
235 0.15
236 0.17
237 0.2
238 0.23
239 0.31
240 0.38
241 0.4
242 0.46
243 0.45
244 0.45
245 0.43
246 0.42
247 0.37
248 0.35
249 0.34
250 0.32
251 0.37
252 0.36
253 0.35
254 0.29
255 0.29
256 0.25
257 0.23
258 0.22
259 0.17
260 0.15
261 0.17
262 0.18
263 0.16
264 0.16
265 0.14
266 0.13
267 0.15
268 0.15
269 0.14
270 0.17
271 0.17
272 0.16
273 0.21
274 0.29
275 0.35
276 0.45
277 0.55
278 0.61
279 0.7
280 0.79
281 0.84
282 0.83
283 0.84
284 0.79
285 0.75
286 0.7
287 0.62
288 0.62
289 0.55
290 0.46
291 0.42
292 0.39
293 0.32
294 0.28
295 0.3
296 0.22
297 0.19
298 0.19
299 0.15
300 0.15
301 0.16
302 0.16
303 0.16
304 0.15
305 0.15
306 0.15
307 0.12
308 0.1
309 0.09
310 0.08
311 0.05
312 0.04
313 0.04
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.03
320 0.03
321 0.04
322 0.04
323 0.04
324 0.04
325 0.05
326 0.06
327 0.06
328 0.06
329 0.09
330 0.09
331 0.09
332 0.1
333 0.11
334 0.15
335 0.22
336 0.25
337 0.29
338 0.37