Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QAJ7

Protein Details
Accession W1QAJ7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFKKRNVKQEQKRKREVEGTBasic
133-153KVVKNPKKREWEEVLKKNKRFBasic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR039971  CWC24-like  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG opa:HPODL_01518  -  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MFKKRNVKQEQKRKREVEGTGDGGDVVKKSKTEKRGLDTLTRVDGKKESESKVIKQAVSKEQDEESQSEDQSDQSKDVMENKSGRYNIKQLSSSIKTNTVIDYQPDVCKDFLKNGYCGYGDTCKFLHYRDEFKVVKNPKKREWEEVLKKNKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.72
4 0.69
5 0.64
6 0.57
7 0.47
8 0.43
9 0.35
10 0.28
11 0.25
12 0.17
13 0.12
14 0.1
15 0.1
16 0.16
17 0.23
18 0.3
19 0.38
20 0.44
21 0.48
22 0.54
23 0.57
24 0.57
25 0.54
26 0.49
27 0.45
28 0.42
29 0.36
30 0.31
31 0.3
32 0.26
33 0.3
34 0.32
35 0.29
36 0.33
37 0.36
38 0.37
39 0.43
40 0.43
41 0.38
42 0.36
43 0.39
44 0.38
45 0.39
46 0.37
47 0.31
48 0.28
49 0.29
50 0.28
51 0.24
52 0.2
53 0.16
54 0.16
55 0.14
56 0.14
57 0.12
58 0.14
59 0.13
60 0.1
61 0.09
62 0.1
63 0.1
64 0.15
65 0.15
66 0.16
67 0.17
68 0.18
69 0.23
70 0.23
71 0.25
72 0.22
73 0.26
74 0.26
75 0.28
76 0.27
77 0.24
78 0.3
79 0.32
80 0.31
81 0.28
82 0.27
83 0.25
84 0.25
85 0.25
86 0.2
87 0.17
88 0.16
89 0.18
90 0.17
91 0.18
92 0.19
93 0.19
94 0.17
95 0.18
96 0.18
97 0.2
98 0.24
99 0.26
100 0.26
101 0.25
102 0.27
103 0.25
104 0.25
105 0.23
106 0.23
107 0.21
108 0.22
109 0.21
110 0.21
111 0.22
112 0.22
113 0.28
114 0.25
115 0.31
116 0.32
117 0.41
118 0.4
119 0.43
120 0.51
121 0.52
122 0.57
123 0.6
124 0.64
125 0.65
126 0.75
127 0.76
128 0.75
129 0.75
130 0.77
131 0.78
132 0.8
133 0.82