Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QIK5

Protein Details
Accession W1QIK5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
463-483GYEHKPKKYIKAGIRAHKRHSBasic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013057  AA_transpt_TM  
Gene Ontology GO:0005774  C:vacuolar membrane  
KEGG opa:HPODL_00858  -  
Pfam View protein in Pfam  
PF01490  Aa_trans  
Amino Acid Sequences MKTEVNVSAQTVEPAAVPLVTRLFYAQRFIEKQYEEVKNEAHLRWWNQWIYRTLKIQSLEPASEYTTWKDDSLAERNSHWLACAGLLTTEIMGAMLVPQSMSYLGYVPGNIMLFVFFGFALVAGGLVWWLFILFDSPEYPIRTFADIAELLGGKTWRHLIVFLQVVAMILTSATIIIGAVEGLEIMRDQRVCFCGLVVLLCGVQAIIGHLKQLKQLGNLCVWISIINYVCLFAQLGFFKEPNWDNAKAVLGLDRGEVHSYAVAPQDFVSRLVSVTSLSYVFAGLLVFPEILAEMRRPWDFWKSMLLAQVCILATYLLYGNFVYARQGQFSNSPAALGIANIAALRGFGFVTFITGFVQATFYGHLSAKVFYKNYLPDIFKNLRFNSVRGTLLWSATVCLVWVVIFLISAGVPNVMAVAAFTSALTMIPLTYMFPYLFNVWALCVKTNAENIICYDAVAMKTEGYEHKPKKYIKAGIRAHKRHSGVFLSILFLASVFAVMGIAGSIGYMVYVFANTSAESFSCKSPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.09
4 0.09
5 0.1
6 0.11
7 0.11
8 0.11
9 0.13
10 0.17
11 0.18
12 0.22
13 0.23
14 0.29
15 0.32
16 0.36
17 0.41
18 0.38
19 0.41
20 0.46
21 0.5
22 0.44
23 0.44
24 0.41
25 0.4
26 0.43
27 0.4
28 0.36
29 0.36
30 0.38
31 0.42
32 0.48
33 0.47
34 0.46
35 0.51
36 0.51
37 0.51
38 0.52
39 0.51
40 0.46
41 0.47
42 0.44
43 0.41
44 0.42
45 0.4
46 0.35
47 0.31
48 0.3
49 0.27
50 0.28
51 0.27
52 0.23
53 0.22
54 0.22
55 0.21
56 0.21
57 0.22
58 0.25
59 0.31
60 0.33
61 0.31
62 0.31
63 0.35
64 0.35
65 0.32
66 0.26
67 0.2
68 0.15
69 0.14
70 0.13
71 0.1
72 0.08
73 0.08
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.07
92 0.08
93 0.08
94 0.08
95 0.09
96 0.09
97 0.08
98 0.07
99 0.07
100 0.06
101 0.06
102 0.07
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.04
120 0.04
121 0.06
122 0.06
123 0.09
124 0.12
125 0.15
126 0.16
127 0.17
128 0.18
129 0.19
130 0.19
131 0.17
132 0.18
133 0.16
134 0.15
135 0.15
136 0.13
137 0.11
138 0.12
139 0.12
140 0.07
141 0.09
142 0.1
143 0.1
144 0.1
145 0.11
146 0.1
147 0.15
148 0.17
149 0.15
150 0.14
151 0.13
152 0.12
153 0.11
154 0.1
155 0.05
156 0.03
157 0.03
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.03
173 0.05
174 0.06
175 0.06
176 0.09
177 0.11
178 0.12
179 0.12
180 0.11
181 0.1
182 0.1
183 0.1
184 0.08
185 0.07
186 0.05
187 0.05
188 0.05
189 0.04
190 0.03
191 0.03
192 0.04
193 0.05
194 0.05
195 0.07
196 0.08
197 0.09
198 0.11
199 0.15
200 0.16
201 0.18
202 0.21
203 0.22
204 0.22
205 0.22
206 0.2
207 0.16
208 0.15
209 0.12
210 0.08
211 0.09
212 0.08
213 0.08
214 0.07
215 0.08
216 0.07
217 0.07
218 0.07
219 0.05
220 0.07
221 0.07
222 0.08
223 0.09
224 0.09
225 0.09
226 0.13
227 0.14
228 0.16
229 0.21
230 0.2
231 0.19
232 0.2
233 0.21
234 0.17
235 0.16
236 0.13
237 0.09
238 0.08
239 0.08
240 0.07
241 0.07
242 0.08
243 0.08
244 0.06
245 0.06
246 0.06
247 0.07
248 0.08
249 0.07
250 0.07
251 0.07
252 0.09
253 0.09
254 0.09
255 0.09
256 0.08
257 0.08
258 0.08
259 0.08
260 0.06
261 0.06
262 0.06
263 0.05
264 0.05
265 0.05
266 0.05
267 0.05
268 0.05
269 0.04
270 0.03
271 0.03
272 0.04
273 0.04
274 0.03
275 0.03
276 0.03
277 0.04
278 0.04
279 0.05
280 0.05
281 0.08
282 0.08
283 0.09
284 0.11
285 0.17
286 0.17
287 0.17
288 0.21
289 0.21
290 0.22
291 0.26
292 0.24
293 0.19
294 0.18
295 0.19
296 0.14
297 0.12
298 0.11
299 0.06
300 0.05
301 0.06
302 0.06
303 0.04
304 0.05
305 0.05
306 0.05
307 0.06
308 0.06
309 0.07
310 0.1
311 0.1
312 0.11
313 0.12
314 0.13
315 0.15
316 0.16
317 0.18
318 0.14
319 0.14
320 0.12
321 0.12
322 0.11
323 0.09
324 0.07
325 0.04
326 0.05
327 0.04
328 0.04
329 0.03
330 0.03
331 0.04
332 0.04
333 0.04
334 0.03
335 0.04
336 0.04
337 0.07
338 0.07
339 0.07
340 0.07
341 0.08
342 0.08
343 0.07
344 0.08
345 0.06
346 0.07
347 0.07
348 0.07
349 0.09
350 0.09
351 0.1
352 0.11
353 0.12
354 0.14
355 0.17
356 0.17
357 0.16
358 0.2
359 0.21
360 0.24
361 0.28
362 0.28
363 0.27
364 0.34
365 0.38
366 0.38
367 0.43
368 0.4
369 0.43
370 0.41
371 0.4
372 0.38
373 0.36
374 0.33
375 0.27
376 0.31
377 0.24
378 0.23
379 0.23
380 0.18
381 0.15
382 0.14
383 0.14
384 0.08
385 0.06
386 0.06
387 0.05
388 0.05
389 0.04
390 0.04
391 0.04
392 0.04
393 0.04
394 0.04
395 0.04
396 0.04
397 0.04
398 0.04
399 0.04
400 0.04
401 0.03
402 0.03
403 0.03
404 0.04
405 0.04
406 0.04
407 0.04
408 0.04
409 0.04
410 0.05
411 0.05
412 0.04
413 0.04
414 0.04
415 0.05
416 0.06
417 0.06
418 0.08
419 0.08
420 0.09
421 0.11
422 0.12
423 0.13
424 0.13
425 0.12
426 0.12
427 0.15
428 0.16
429 0.15
430 0.15
431 0.15
432 0.18
433 0.2
434 0.22
435 0.19
436 0.19
437 0.2
438 0.22
439 0.2
440 0.17
441 0.16
442 0.15
443 0.14
444 0.16
445 0.15
446 0.11
447 0.11
448 0.14
449 0.17
450 0.21
451 0.31
452 0.33
453 0.41
454 0.48
455 0.52
456 0.59
457 0.65
458 0.68
459 0.66
460 0.72
461 0.73
462 0.76
463 0.83
464 0.81
465 0.77
466 0.76
467 0.71
468 0.63
469 0.6
470 0.54
471 0.46
472 0.43
473 0.37
474 0.31
475 0.29
476 0.25
477 0.19
478 0.14
479 0.12
480 0.08
481 0.07
482 0.05
483 0.04
484 0.04
485 0.04
486 0.04
487 0.03
488 0.03
489 0.03
490 0.03
491 0.03
492 0.03
493 0.03
494 0.03
495 0.03
496 0.04
497 0.04
498 0.05
499 0.05
500 0.07
501 0.07
502 0.08
503 0.09
504 0.09
505 0.13
506 0.16