Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QGI8

Protein Details
Accession W1QGI8   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
183-210EGLHHSLKARKKRKSVSGEKSAKRSKIKBasic
NLS Segment(s)
PositionSequence
189-214LKARKKRKSVSGEKSAKRSKIKSAKP
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
KEGG opa:HPODL_00177  -  
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences MGNDGGSIPSRKLIVNFYASDKAKEKGKPFNAFAVCALSNEKLNRPVVSDYRGQLFNKDTLLEFLLNKEYLKNEKLGHITSLKDVVELNIKLDENKLKCELTSSEYDIMSNVLPKFAYVVPCGCVMLKNNLLSLLSSTKPGEYATTRCPICNTEFFSRDVIEIEPDEDELRVLEKRMKLLETEGLHHSLKARKKRKSVSGEKSAKRSKIKSAKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.28
4 0.31
5 0.37
6 0.37
7 0.4
8 0.38
9 0.36
10 0.38
11 0.42
12 0.42
13 0.45
14 0.52
15 0.55
16 0.55
17 0.61
18 0.56
19 0.51
20 0.47
21 0.41
22 0.33
23 0.26
24 0.26
25 0.19
26 0.21
27 0.22
28 0.24
29 0.24
30 0.25
31 0.25
32 0.25
33 0.29
34 0.28
35 0.3
36 0.3
37 0.27
38 0.29
39 0.33
40 0.3
41 0.28
42 0.28
43 0.26
44 0.23
45 0.22
46 0.18
47 0.16
48 0.17
49 0.16
50 0.13
51 0.13
52 0.14
53 0.14
54 0.14
55 0.13
56 0.14
57 0.16
58 0.18
59 0.19
60 0.18
61 0.21
62 0.24
63 0.24
64 0.24
65 0.22
66 0.21
67 0.19
68 0.21
69 0.17
70 0.14
71 0.13
72 0.11
73 0.14
74 0.14
75 0.13
76 0.13
77 0.13
78 0.13
79 0.14
80 0.19
81 0.15
82 0.17
83 0.18
84 0.17
85 0.16
86 0.19
87 0.18
88 0.16
89 0.17
90 0.17
91 0.17
92 0.17
93 0.17
94 0.15
95 0.14
96 0.11
97 0.11
98 0.09
99 0.07
100 0.07
101 0.07
102 0.09
103 0.1
104 0.11
105 0.1
106 0.1
107 0.11
108 0.12
109 0.12
110 0.1
111 0.1
112 0.1
113 0.14
114 0.16
115 0.15
116 0.15
117 0.15
118 0.15
119 0.14
120 0.14
121 0.13
122 0.1
123 0.11
124 0.12
125 0.11
126 0.11
127 0.12
128 0.13
129 0.12
130 0.16
131 0.18
132 0.25
133 0.25
134 0.25
135 0.26
136 0.26
137 0.27
138 0.29
139 0.31
140 0.3
141 0.32
142 0.33
143 0.33
144 0.31
145 0.27
146 0.24
147 0.18
148 0.14
149 0.12
150 0.12
151 0.1
152 0.1
153 0.1
154 0.09
155 0.08
156 0.07
157 0.08
158 0.08
159 0.09
160 0.14
161 0.16
162 0.19
163 0.22
164 0.22
165 0.22
166 0.24
167 0.29
168 0.26
169 0.28
170 0.27
171 0.29
172 0.28
173 0.27
174 0.29
175 0.29
176 0.36
177 0.43
178 0.5
179 0.55
180 0.65
181 0.74
182 0.8
183 0.84
184 0.86
185 0.85
186 0.87
187 0.88
188 0.84
189 0.85
190 0.83
191 0.8
192 0.78
193 0.72
194 0.72