Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QGT0

Protein Details
Accession W1QGT0    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
181-231LSSPRRQTHSQSPPKPKPQPKKHHMAPPDTTIFTRKPTYIRKQHRSPSDQAHydrophilic
NLS Segment(s)
PositionSequence
196-201PKPQPK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, cyto 3, mito 2
Family & Domain DBs
KEGG opa:HPODL_03431  -  
Amino Acid Sequences MRKHTGHKILLDQDYFDPLSVQVDVGLPPPPSPSHKIEQFKLKTRSFSHTSHSPFSAQVSISPGSDHVSSQFAQHSFSNRHTMTEKKLGSSPKRAASSPLQLENNGSDSSLVTSFINSYKDMGDSDSYPANSDSEHSLFSLQTHSSKESLPKADFINTYSKPLPSIPIETFNQADVRDYNLSSPRRQTHSQSPPKPKPQPKKHHMAPPDTTIFTRKPTYIRKQHRSPSDQAVRDAGIEPFMLGGYQPTKTLKIVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.27
4 0.2
5 0.15
6 0.16
7 0.13
8 0.12
9 0.09
10 0.09
11 0.1
12 0.1
13 0.13
14 0.12
15 0.12
16 0.15
17 0.17
18 0.21
19 0.26
20 0.3
21 0.35
22 0.44
23 0.5
24 0.52
25 0.6
26 0.62
27 0.66
28 0.69
29 0.65
30 0.62
31 0.6
32 0.62
33 0.57
34 0.52
35 0.49
36 0.49
37 0.51
38 0.48
39 0.46
40 0.4
41 0.35
42 0.34
43 0.3
44 0.22
45 0.19
46 0.19
47 0.18
48 0.16
49 0.16
50 0.14
51 0.14
52 0.14
53 0.13
54 0.1
55 0.12
56 0.12
57 0.13
58 0.16
59 0.14
60 0.16
61 0.18
62 0.22
63 0.23
64 0.25
65 0.31
66 0.28
67 0.3
68 0.3
69 0.32
70 0.33
71 0.38
72 0.36
73 0.3
74 0.34
75 0.4
76 0.42
77 0.47
78 0.46
79 0.43
80 0.45
81 0.44
82 0.44
83 0.41
84 0.43
85 0.38
86 0.38
87 0.33
88 0.31
89 0.31
90 0.28
91 0.25
92 0.17
93 0.14
94 0.09
95 0.08
96 0.09
97 0.08
98 0.09
99 0.06
100 0.06
101 0.07
102 0.09
103 0.1
104 0.09
105 0.09
106 0.09
107 0.09
108 0.09
109 0.1
110 0.09
111 0.08
112 0.1
113 0.1
114 0.1
115 0.1
116 0.1
117 0.09
118 0.08
119 0.08
120 0.09
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.11
128 0.09
129 0.1
130 0.11
131 0.12
132 0.13
133 0.14
134 0.18
135 0.2
136 0.24
137 0.22
138 0.23
139 0.23
140 0.25
141 0.24
142 0.22
143 0.25
144 0.22
145 0.25
146 0.24
147 0.23
148 0.21
149 0.21
150 0.23
151 0.17
152 0.21
153 0.18
154 0.22
155 0.23
156 0.23
157 0.24
158 0.21
159 0.21
160 0.16
161 0.16
162 0.12
163 0.15
164 0.14
165 0.14
166 0.16
167 0.22
168 0.25
169 0.26
170 0.32
171 0.34
172 0.39
173 0.42
174 0.45
175 0.49
176 0.57
177 0.65
178 0.68
179 0.74
180 0.77
181 0.84
182 0.88
183 0.87
184 0.87
185 0.88
186 0.89
187 0.86
188 0.88
189 0.85
190 0.85
191 0.81
192 0.78
193 0.72
194 0.67
195 0.64
196 0.55
197 0.48
198 0.43
199 0.38
200 0.34
201 0.33
202 0.28
203 0.31
204 0.39
205 0.49
206 0.56
207 0.65
208 0.7
209 0.77
210 0.83
211 0.86
212 0.83
213 0.78
214 0.78
215 0.77
216 0.71
217 0.63
218 0.57
219 0.48
220 0.42
221 0.38
222 0.27
223 0.19
224 0.15
225 0.13
226 0.1
227 0.09
228 0.08
229 0.06
230 0.09
231 0.1
232 0.11
233 0.14
234 0.16
235 0.19