Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QKT1

Protein Details
Accession W1QKT1    Localization Confidence High Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MVPKKQTKAAKRRSTQNQKREVEPHydrophilic
37-64ASQPKLTPKSEKRQVKKSQLKKELRIAKHydrophilic
NLS Segment(s)
PositionSequence
44-72PKSEKRQVKKSQLKKELRIAKLYGKKKEK
93-102LKKRGKKGKK
135-195KRLEEIRELRRQEMERKEQEKKMKVEDKKEEIKLKAATARSIRRKNAKLAKKEILKPDSKK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
KEGG opa:HPODL_00837  -  
Amino Acid Sequences MVPKKQTKAAKRRSTQNQKREVEPEVRQDSLARNMLASQPKLTPKSEKRQVKKSQLKKELRIAKLYGKKKEKVYDEKELDIPVLNKAIQPGVLKKRGKKGKKFVADNDSITLNRLIRQINDEKDLENESKLEKAKRLEEIRELRRQEMERKEQEKKMKVEDKKEEIKLKAATARSIRRKNAKLAKKEILKPDSKKSVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.89
4 0.88
5 0.81
6 0.79
7 0.73
8 0.67
9 0.63
10 0.58
11 0.57
12 0.51
13 0.47
14 0.42
15 0.4
16 0.38
17 0.37
18 0.36
19 0.26
20 0.22
21 0.23
22 0.28
23 0.32
24 0.29
25 0.25
26 0.26
27 0.32
28 0.34
29 0.36
30 0.4
31 0.43
32 0.52
33 0.6
34 0.65
35 0.67
36 0.74
37 0.81
38 0.83
39 0.85
40 0.84
41 0.85
42 0.86
43 0.86
44 0.82
45 0.82
46 0.8
47 0.72
48 0.66
49 0.58
50 0.56
51 0.57
52 0.58
53 0.58
54 0.56
55 0.58
56 0.59
57 0.64
58 0.63
59 0.63
60 0.63
61 0.63
62 0.59
63 0.57
64 0.52
65 0.45
66 0.37
67 0.29
68 0.23
69 0.13
70 0.12
71 0.1
72 0.09
73 0.09
74 0.09
75 0.09
76 0.1
77 0.15
78 0.2
79 0.28
80 0.31
81 0.34
82 0.43
83 0.51
84 0.58
85 0.61
86 0.65
87 0.66
88 0.72
89 0.73
90 0.69
91 0.67
92 0.61
93 0.53
94 0.45
95 0.36
96 0.28
97 0.24
98 0.2
99 0.13
100 0.12
101 0.14
102 0.13
103 0.12
104 0.17
105 0.21
106 0.22
107 0.25
108 0.24
109 0.22
110 0.23
111 0.25
112 0.21
113 0.16
114 0.15
115 0.12
116 0.15
117 0.18
118 0.19
119 0.2
120 0.23
121 0.25
122 0.33
123 0.36
124 0.35
125 0.41
126 0.48
127 0.5
128 0.55
129 0.54
130 0.47
131 0.49
132 0.5
133 0.49
134 0.49
135 0.52
136 0.54
137 0.58
138 0.63
139 0.65
140 0.71
141 0.7
142 0.65
143 0.66
144 0.66
145 0.66
146 0.68
147 0.7
148 0.69
149 0.69
150 0.72
151 0.69
152 0.62
153 0.62
154 0.54
155 0.49
156 0.47
157 0.4
158 0.39
159 0.4
160 0.49
161 0.53
162 0.59
163 0.63
164 0.68
165 0.71
166 0.75
167 0.78
168 0.78
169 0.77
170 0.77
171 0.79
172 0.77
173 0.8
174 0.79
175 0.77
176 0.77
177 0.73
178 0.74
179 0.75
180 0.68