Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1Q8J9

Protein Details
Accession W1Q8J9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-101QMKEKEKQREQKTKSLKNAKTRTGHydrophilic
NLS Segment(s)
PositionSequence
55-97KIKQERKERSRLQKIERTRQKLQQMKEKEKQREQKTKSLKNAK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013730  Fyv7/TAP26  
KEGG opa:HPODL_05358  -  
Pfam View protein in Pfam  
PF08524  rRNA_processing  
Amino Acid Sequences MSKKYDRETKTRDIKKALAHRANLRRSYFKLVNQEKTQSEEPKPFKPLTYQDRIKIKQERKERSRLQKIERTRQKLQQMKEKEKQREQKTKSLKNAKTRTGQPLMAPRINDLLDKIKKEVKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.72
4 0.72
5 0.68
6 0.65
7 0.68
8 0.71
9 0.74
10 0.71
11 0.66
12 0.6
13 0.57
14 0.6
15 0.55
16 0.51
17 0.54
18 0.55
19 0.58
20 0.56
21 0.57
22 0.49
23 0.5
24 0.5
25 0.44
26 0.41
27 0.42
28 0.43
29 0.42
30 0.45
31 0.4
32 0.36
33 0.36
34 0.4
35 0.38
36 0.43
37 0.43
38 0.45
39 0.53
40 0.54
41 0.56
42 0.57
43 0.56
44 0.54
45 0.61
46 0.64
47 0.61
48 0.68
49 0.7
50 0.72
51 0.76
52 0.74
53 0.72
54 0.7
55 0.72
56 0.74
57 0.74
58 0.71
59 0.66
60 0.67
61 0.69
62 0.68
63 0.66
64 0.64
65 0.65
66 0.66
67 0.69
68 0.71
69 0.7
70 0.73
71 0.78
72 0.78
73 0.79
74 0.76
75 0.78
76 0.79
77 0.79
78 0.81
79 0.82
80 0.78
81 0.79
82 0.81
83 0.78
84 0.75
85 0.72
86 0.7
87 0.64
88 0.59
89 0.53
90 0.55
91 0.55
92 0.51
93 0.45
94 0.39
95 0.37
96 0.36
97 0.32
98 0.26
99 0.28
100 0.31
101 0.33
102 0.35