Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q2H4X5

Protein Details
Accession Q2H4X5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-94IVRFLAQKWKRQKERRITEDLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009783  DUF1348  
IPR032710  NTF2-like_dom_sf  
Pfam View protein in Pfam  
PF07080  DUF1348  
Amino Acid Sequences MASYLTTYPKTDSSSFLNSESGWLTRPPFTPETAYQKVKTGQEIWNGEHLQSIFTYNSTWREGNSLLQGRAEIVRFLAQKWKRQKERRITEDLIAFTDNRVCFLKLLSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.31
4 0.3
5 0.25
6 0.25
7 0.23
8 0.18
9 0.14
10 0.14
11 0.15
12 0.17
13 0.19
14 0.23
15 0.22
16 0.24
17 0.27
18 0.3
19 0.37
20 0.4
21 0.42
22 0.37
23 0.39
24 0.42
25 0.38
26 0.36
27 0.31
28 0.28
29 0.31
30 0.33
31 0.31
32 0.32
33 0.31
34 0.28
35 0.26
36 0.22
37 0.15
38 0.13
39 0.13
40 0.08
41 0.08
42 0.08
43 0.08
44 0.1
45 0.13
46 0.13
47 0.11
48 0.13
49 0.14
50 0.15
51 0.2
52 0.2
53 0.18
54 0.18
55 0.18
56 0.16
57 0.17
58 0.16
59 0.1
60 0.08
61 0.12
62 0.12
63 0.13
64 0.22
65 0.24
66 0.32
67 0.43
68 0.52
69 0.59
70 0.68
71 0.78
72 0.79
73 0.86
74 0.85
75 0.83
76 0.76
77 0.71
78 0.66
79 0.57
80 0.48
81 0.38
82 0.31
83 0.23
84 0.26
85 0.2
86 0.18
87 0.2
88 0.19
89 0.18