Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1QBQ5

Protein Details
Accession W1QBQ5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-37QGSSKIKKKIRDITRLLKRDNHydrophilic
71-96QRYHKVRFFERKKAVRRYKKALKELKBasic
NLS Segment(s)
PositionSequence
67-117KKLAQRYHKVRFFERKKAVRRYKKALKELKELEAKDGDPKAIKKEIKKQKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
KEGG opa:HPODL_04079  -  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MAKAHSSGVDISGVIGQGSSKIKKKIRDITRLLKRDNLASNVRIENERALEALKSELATVQTNLKAKKLAQRYHKVRFFERKKAVRRYKKALKELKELEAKDGDPKAIKKEIKKQKKVVRHCEVDLAYVLNFPKTEKYIALYPANTDTSGLSEKALRGIQKTEAKRTEYRKKFGELLDSGKLEVSLEDGIKIINKETIDWRPEQAETAADQKQTTQDDEFFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.1
5 0.15
6 0.2
7 0.25
8 0.33
9 0.39
10 0.47
11 0.56
12 0.63
13 0.67
14 0.72
15 0.75
16 0.77
17 0.82
18 0.82
19 0.75
20 0.71
21 0.63
22 0.59
23 0.55
24 0.5
25 0.44
26 0.39
27 0.41
28 0.37
29 0.37
30 0.32
31 0.28
32 0.25
33 0.22
34 0.2
35 0.16
36 0.15
37 0.13
38 0.12
39 0.12
40 0.1
41 0.08
42 0.08
43 0.09
44 0.1
45 0.11
46 0.11
47 0.14
48 0.17
49 0.21
50 0.21
51 0.22
52 0.22
53 0.23
54 0.3
55 0.36
56 0.39
57 0.45
58 0.55
59 0.61
60 0.69
61 0.72
62 0.68
63 0.66
64 0.7
65 0.67
66 0.67
67 0.69
68 0.68
69 0.71
70 0.78
71 0.82
72 0.81
73 0.82
74 0.82
75 0.82
76 0.82
77 0.83
78 0.8
79 0.74
80 0.72
81 0.68
82 0.64
83 0.6
84 0.51
85 0.44
86 0.37
87 0.32
88 0.27
89 0.24
90 0.18
91 0.15
92 0.16
93 0.17
94 0.22
95 0.25
96 0.26
97 0.36
98 0.46
99 0.54
100 0.61
101 0.66
102 0.68
103 0.75
104 0.8
105 0.8
106 0.78
107 0.71
108 0.64
109 0.61
110 0.53
111 0.44
112 0.35
113 0.25
114 0.17
115 0.14
116 0.13
117 0.08
118 0.08
119 0.07
120 0.09
121 0.1
122 0.11
123 0.1
124 0.13
125 0.15
126 0.19
127 0.21
128 0.2
129 0.19
130 0.21
131 0.21
132 0.18
133 0.16
134 0.12
135 0.12
136 0.13
137 0.12
138 0.1
139 0.11
140 0.11
141 0.13
142 0.15
143 0.14
144 0.14
145 0.16
146 0.23
147 0.3
148 0.33
149 0.39
150 0.41
151 0.46
152 0.51
153 0.58
154 0.62
155 0.62
156 0.64
157 0.6
158 0.59
159 0.59
160 0.55
161 0.54
162 0.46
163 0.43
164 0.41
165 0.38
166 0.33
167 0.28
168 0.26
169 0.18
170 0.15
171 0.12
172 0.09
173 0.09
174 0.09
175 0.08
176 0.09
177 0.11
178 0.12
179 0.11
180 0.12
181 0.12
182 0.14
183 0.2
184 0.27
185 0.28
186 0.3
187 0.31
188 0.31
189 0.31
190 0.31
191 0.26
192 0.21
193 0.2
194 0.23
195 0.24
196 0.23
197 0.22
198 0.22
199 0.26
200 0.27
201 0.28
202 0.26