Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QJJ6

Protein Details
Accession W1QJJ6   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-120RAKIERIKERRAKKEEKERYERLAAVMHAKKVERLKRREKRNKLLKERBasic
NLS Segment(s)
PositionSequence
17-120RGPRVSGKDWKVEKKAFRLKANGMHRSWEKKQEQRLKDEQLKAKLKELQEAKEAEKRAKIERIKERRAKKEEKERYERLAAVMHAKKVERLKRREKRNKLLKER
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG opa:HPODL_05127  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTKDTEGSTLLAKDPGRGPRVSGKDWKVEKKAFRLKANGMHRSWEKKQEQRLKDEQLKAKLKELQEAKEAEKRAKIERIKERRAKKEEKERYERLAAVMHAKKVERLKRREKRNKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.31
4 0.3
5 0.32
6 0.37
7 0.42
8 0.44
9 0.47
10 0.45
11 0.5
12 0.57
13 0.61
14 0.59
15 0.6
16 0.6
17 0.62
18 0.68
19 0.65
20 0.63
21 0.62
22 0.59
23 0.61
24 0.64
25 0.61
26 0.52
27 0.5
28 0.5
29 0.51
30 0.5
31 0.51
32 0.49
33 0.48
34 0.58
35 0.62
36 0.61
37 0.62
38 0.64
39 0.63
40 0.63
41 0.63
42 0.59
43 0.58
44 0.6
45 0.54
46 0.51
47 0.47
48 0.4
49 0.4
50 0.37
51 0.3
52 0.28
53 0.29
54 0.28
55 0.29
56 0.3
57 0.25
58 0.26
59 0.26
60 0.26
61 0.32
62 0.33
63 0.37
64 0.47
65 0.55
66 0.62
67 0.68
68 0.73
69 0.75
70 0.8
71 0.8
72 0.78
73 0.8
74 0.81
75 0.82
76 0.82
77 0.77
78 0.74
79 0.69
80 0.61
81 0.51
82 0.44
83 0.35
84 0.35
85 0.34
86 0.3
87 0.29
88 0.29
89 0.33
90 0.38
91 0.46
92 0.47
93 0.53
94 0.63
95 0.69
96 0.8
97 0.86
98 0.88
99 0.9
100 0.91