Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R3C9

Protein Details
Accession C4R3C9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-80EEERQIQKRKKQNTFVPPEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 15.333, cyto 10, mito_nucl 9.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR016082  Ribosomal_L30_ferredoxin-like  
IPR039699  Ribosomal_L7/L30  
IPR035808  Ribosomal_L7_euk_arc  
KEGG ppa:PAS_chr3_0038  -  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
CDD cd01657  Ribosomal_L7_archeal_euk  
Amino Acid Sequences MLQLIAPDEIFFLNFLREKEKIIPPNQSMSSTQTETEVLLKKRKNDEVARMEKAESLRQAEEERQIQKRKKQNTFVPPEYLALRHLASEREQHRIDRVLKVEKELKQKAISSDKTQQEQDQGKLVFVVRVQGPKRAHLPQQVDLILKLLRLTEMNTGVFVRETSSVIPLLKVIRAHVVIGEPSLYTVRSLVQKRAKITIEGENGPRSVELNDNNVIEDKLGDYGIVCMEDIIHEIFSLEENFKVVNKFLNPFQLSPPESGWGPESKLRKLVAEESKSKVSNSGRAELEYVDIDKYIEEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.2
4 0.2
5 0.24
6 0.31
7 0.39
8 0.43
9 0.45
10 0.53
11 0.51
12 0.58
13 0.56
14 0.52
15 0.45
16 0.42
17 0.42
18 0.35
19 0.32
20 0.26
21 0.25
22 0.23
23 0.27
24 0.29
25 0.27
26 0.34
27 0.37
28 0.43
29 0.5
30 0.56
31 0.58
32 0.58
33 0.64
34 0.66
35 0.7
36 0.67
37 0.61
38 0.55
39 0.5
40 0.45
41 0.39
42 0.32
43 0.29
44 0.25
45 0.25
46 0.27
47 0.27
48 0.31
49 0.32
50 0.35
51 0.39
52 0.47
53 0.52
54 0.58
55 0.64
56 0.69
57 0.72
58 0.75
59 0.77
60 0.79
61 0.82
62 0.77
63 0.73
64 0.64
65 0.56
66 0.48
67 0.39
68 0.29
69 0.21
70 0.17
71 0.14
72 0.14
73 0.13
74 0.14
75 0.21
76 0.22
77 0.27
78 0.28
79 0.28
80 0.3
81 0.35
82 0.36
83 0.33
84 0.36
85 0.37
86 0.36
87 0.4
88 0.44
89 0.43
90 0.49
91 0.47
92 0.46
93 0.41
94 0.42
95 0.43
96 0.45
97 0.42
98 0.38
99 0.44
100 0.44
101 0.44
102 0.44
103 0.4
104 0.39
105 0.39
106 0.35
107 0.32
108 0.28
109 0.25
110 0.24
111 0.23
112 0.16
113 0.13
114 0.14
115 0.1
116 0.16
117 0.17
118 0.23
119 0.23
120 0.25
121 0.29
122 0.3
123 0.33
124 0.34
125 0.37
126 0.34
127 0.36
128 0.35
129 0.31
130 0.27
131 0.25
132 0.18
133 0.14
134 0.11
135 0.07
136 0.06
137 0.06
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.09
146 0.08
147 0.07
148 0.06
149 0.07
150 0.07
151 0.08
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.1
158 0.09
159 0.09
160 0.1
161 0.11
162 0.11
163 0.1
164 0.1
165 0.09
166 0.08
167 0.08
168 0.05
169 0.06
170 0.06
171 0.06
172 0.05
173 0.05
174 0.08
175 0.14
176 0.16
177 0.24
178 0.3
179 0.34
180 0.36
181 0.41
182 0.4
183 0.35
184 0.37
185 0.36
186 0.34
187 0.33
188 0.33
189 0.29
190 0.28
191 0.26
192 0.23
193 0.16
194 0.13
195 0.15
196 0.14
197 0.17
198 0.19
199 0.19
200 0.19
201 0.19
202 0.18
203 0.14
204 0.12
205 0.09
206 0.07
207 0.07
208 0.06
209 0.05
210 0.06
211 0.06
212 0.06
213 0.05
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.06
220 0.05
221 0.06
222 0.06
223 0.07
224 0.09
225 0.08
226 0.08
227 0.08
228 0.09
229 0.11
230 0.12
231 0.11
232 0.14
233 0.17
234 0.19
235 0.21
236 0.3
237 0.31
238 0.31
239 0.35
240 0.38
241 0.37
242 0.36
243 0.35
244 0.29
245 0.26
246 0.26
247 0.24
248 0.19
249 0.21
250 0.24
251 0.27
252 0.28
253 0.33
254 0.33
255 0.33
256 0.34
257 0.4
258 0.44
259 0.47
260 0.49
261 0.5
262 0.55
263 0.53
264 0.5
265 0.48
266 0.42
267 0.42
268 0.42
269 0.44
270 0.39
271 0.39
272 0.4
273 0.34
274 0.32
275 0.26
276 0.22
277 0.16
278 0.14
279 0.13
280 0.12