Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QI99

Protein Details
Accession W1QI99    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-42GLLWKKPWRLSRFQKYRHRKRMQLVDANIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG opa:HPODL_04795  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRMSPVALGGLLWKKPWRLSRFQKYRHRKRMQLVDANIQALYDGLQANGMSSKRVEHLMTEYPKESEMTPRNKYTVFSKYARKYRKGIHFVPKWTKIPLRKQPLNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.21
5 0.21
6 0.28
7 0.37
8 0.38
9 0.45
10 0.55
11 0.64
12 0.71
13 0.79
14 0.84
15 0.86
16 0.91
17 0.92
18 0.9
19 0.86
20 0.84
21 0.85
22 0.83
23 0.8
24 0.72
25 0.68
26 0.6
27 0.54
28 0.44
29 0.33
30 0.24
31 0.15
32 0.12
33 0.06
34 0.05
35 0.04
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.06
42 0.06
43 0.07
44 0.08
45 0.1
46 0.1
47 0.08
48 0.12
49 0.18
50 0.2
51 0.22
52 0.21
53 0.2
54 0.21
55 0.21
56 0.18
57 0.19
58 0.25
59 0.3
60 0.34
61 0.36
62 0.38
63 0.37
64 0.39
65 0.36
66 0.35
67 0.33
68 0.33
69 0.41
70 0.47
71 0.56
72 0.62
73 0.62
74 0.61
75 0.65
76 0.71
77 0.7
78 0.69
79 0.7
80 0.69
81 0.74
82 0.77
83 0.75
84 0.67
85 0.66
86 0.66
87 0.65
88 0.68
89 0.7
90 0.71