Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QD51

Protein Details
Accession W1QD51    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNVPKTRKTYCKGKNCRKHTQHRVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG opa:HPODL_04105  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKNCRKHTQHRVTQYKAGKASLYAQGKRRYDRKQSGYGGQTKQVFHKKAKTTKKVVLRLECVSCKTKLQLPLKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.86
4 0.9
5 0.89
6 0.9
7 0.91
8 0.9
9 0.88
10 0.88
11 0.88
12 0.82
13 0.8
14 0.75
15 0.69
16 0.6
17 0.52
18 0.42
19 0.34
20 0.32
21 0.32
22 0.32
23 0.3
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.61
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.61
58 0.57
59 0.55
60 0.5
61 0.44
62 0.39
63 0.34
64 0.3
65 0.28
66 0.29
67 0.34
68 0.42
69 0.46
70 0.5
71 0.6
72 0.68
73 0.73
74 0.71
75 0.66
76 0.64
77 0.59
78 0.59
79 0.59
80 0.59
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57