Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QBS7

Protein Details
Accession W1QBS7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-98EIDKHRRNDAKRQKRENARKRSNDEYEBasic
NLS Segment(s)
PositionSequence
76-92HRRNDAKRQKRENARKR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018464  CENP-O  
Gene Ontology GO:0000776  C:kinetochore  
GO:0005634  C:nucleus  
GO:0034508  P:centromere complex assembly  
KEGG opa:HPODL_01248  -  
Pfam View protein in Pfam  
PF09496  CENP-O  
Amino Acid Sequences MSTIEDLLARKEELEREIADLKQTEKTLDDEILSLDEEVEEDLTKIDEELAHHQYFDELIQNLMTEGIRQVEIDKHRRNDAKRQKRENARKRSNDEYEELRERLQPAICLENAYRLGGLTAFPVNDPQAGESDRFLGIRFDIFDPYSFKYTTPHYVILRKDPKNDLWEVFKTTIPNYVPLNSLAYEHLNDDMIRFAGHVRRHLVQLQLKKAVFLRLQEKLEFPSGLDHDLDFTKISVNIKDKLEIVLICDLYRVTKAMVTYIDPEVSRASKQVEVLLSGLSLNDFDEKFLEVIQAWYKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.23
4 0.26
5 0.26
6 0.26
7 0.25
8 0.25
9 0.26
10 0.26
11 0.23
12 0.21
13 0.23
14 0.23
15 0.22
16 0.21
17 0.16
18 0.16
19 0.16
20 0.15
21 0.12
22 0.09
23 0.08
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.06
33 0.07
34 0.07
35 0.1
36 0.16
37 0.21
38 0.21
39 0.21
40 0.2
41 0.2
42 0.19
43 0.18
44 0.15
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.11
51 0.1
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.14
59 0.22
60 0.31
61 0.38
62 0.39
63 0.47
64 0.54
65 0.57
66 0.62
67 0.66
68 0.68
69 0.72
70 0.78
71 0.8
72 0.84
73 0.91
74 0.9
75 0.9
76 0.89
77 0.88
78 0.84
79 0.83
80 0.78
81 0.71
82 0.63
83 0.57
84 0.53
85 0.49
86 0.43
87 0.36
88 0.31
89 0.29
90 0.28
91 0.24
92 0.19
93 0.16
94 0.18
95 0.17
96 0.17
97 0.16
98 0.17
99 0.17
100 0.16
101 0.14
102 0.11
103 0.11
104 0.09
105 0.09
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.08
114 0.07
115 0.08
116 0.09
117 0.09
118 0.09
119 0.1
120 0.1
121 0.1
122 0.09
123 0.08
124 0.07
125 0.07
126 0.09
127 0.08
128 0.09
129 0.09
130 0.1
131 0.12
132 0.13
133 0.15
134 0.14
135 0.13
136 0.14
137 0.16
138 0.19
139 0.2
140 0.22
141 0.22
142 0.26
143 0.27
144 0.35
145 0.42
146 0.39
147 0.4
148 0.4
149 0.41
150 0.4
151 0.41
152 0.33
153 0.29
154 0.28
155 0.28
156 0.26
157 0.24
158 0.22
159 0.2
160 0.23
161 0.19
162 0.2
163 0.18
164 0.17
165 0.17
166 0.17
167 0.18
168 0.13
169 0.13
170 0.12
171 0.12
172 0.11
173 0.1
174 0.1
175 0.09
176 0.09
177 0.08
178 0.08
179 0.07
180 0.06
181 0.06
182 0.07
183 0.12
184 0.14
185 0.17
186 0.2
187 0.21
188 0.23
189 0.26
190 0.31
191 0.32
192 0.37
193 0.39
194 0.42
195 0.41
196 0.4
197 0.39
198 0.37
199 0.33
200 0.3
201 0.31
202 0.3
203 0.33
204 0.32
205 0.32
206 0.29
207 0.3
208 0.26
209 0.21
210 0.2
211 0.18
212 0.19
213 0.18
214 0.15
215 0.14
216 0.15
217 0.15
218 0.1
219 0.1
220 0.1
221 0.12
222 0.13
223 0.17
224 0.2
225 0.25
226 0.26
227 0.27
228 0.26
229 0.25
230 0.26
231 0.21
232 0.2
233 0.19
234 0.18
235 0.16
236 0.16
237 0.15
238 0.13
239 0.14
240 0.12
241 0.09
242 0.1
243 0.11
244 0.13
245 0.14
246 0.15
247 0.18
248 0.19
249 0.2
250 0.18
251 0.19
252 0.2
253 0.2
254 0.19
255 0.19
256 0.2
257 0.2
258 0.21
259 0.24
260 0.22
261 0.22
262 0.22
263 0.19
264 0.16
265 0.14
266 0.13
267 0.09
268 0.07
269 0.07
270 0.1
271 0.1
272 0.1
273 0.11
274 0.13
275 0.13
276 0.13
277 0.14
278 0.1
279 0.14