Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QKS2

Protein Details
Accession W1QKS2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-52KLLNQKLKQERDLRRERNKLAHydrophilic
211-231FGPKRLEQYKKDRKMNPYSQFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036639  Cyt_c_oxidase_su4_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
KEGG opa:HPODL_02190  -  
Amino Acid Sequences MFRVVRTIRFYSTNQAGANAKTNVAGMMPDAKLLNQKLKQERDLRRERNKLALSSIKDIFAIFSPTAGDDDEFDTANFDPTPVYKNPETYLKLSLPKQHYILEELEDKFKRKWTGIDKDKKRFIYWLAYGPHGPREGFVTEHRKTVVPEKKKSNTLLDQIIAETESQKYKVEVDEYVPPDLPFRTPSVLKSVNPTKDTILSPLPPRDPRLFGPKRLEQYKKDRKMNPYSQFVLGFLMVLTFLNYRKDREVNSTGKVPDYEYLQNDNLLQIDDLSKKLAQAVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.34
5 0.39
6 0.31
7 0.26
8 0.22
9 0.22
10 0.18
11 0.16
12 0.14
13 0.09
14 0.12
15 0.12
16 0.13
17 0.13
18 0.14
19 0.19
20 0.22
21 0.3
22 0.29
23 0.38
24 0.46
25 0.51
26 0.59
27 0.63
28 0.69
29 0.71
30 0.77
31 0.79
32 0.8
33 0.83
34 0.79
35 0.78
36 0.73
37 0.65
38 0.61
39 0.58
40 0.52
41 0.48
42 0.46
43 0.36
44 0.32
45 0.3
46 0.24
47 0.18
48 0.17
49 0.12
50 0.11
51 0.11
52 0.11
53 0.12
54 0.11
55 0.1
56 0.07
57 0.09
58 0.1
59 0.1
60 0.09
61 0.1
62 0.1
63 0.11
64 0.1
65 0.08
66 0.08
67 0.08
68 0.13
69 0.13
70 0.18
71 0.18
72 0.2
73 0.22
74 0.28
75 0.31
76 0.28
77 0.31
78 0.29
79 0.33
80 0.34
81 0.4
82 0.37
83 0.37
84 0.36
85 0.35
86 0.32
87 0.31
88 0.29
89 0.24
90 0.24
91 0.22
92 0.26
93 0.24
94 0.25
95 0.23
96 0.27
97 0.27
98 0.24
99 0.3
100 0.33
101 0.42
102 0.5
103 0.6
104 0.64
105 0.7
106 0.75
107 0.7
108 0.61
109 0.53
110 0.45
111 0.42
112 0.35
113 0.34
114 0.29
115 0.28
116 0.28
117 0.27
118 0.27
119 0.2
120 0.18
121 0.12
122 0.13
123 0.12
124 0.13
125 0.17
126 0.22
127 0.22
128 0.23
129 0.24
130 0.22
131 0.22
132 0.31
133 0.34
134 0.35
135 0.4
136 0.47
137 0.51
138 0.54
139 0.56
140 0.53
141 0.48
142 0.44
143 0.4
144 0.33
145 0.28
146 0.24
147 0.21
148 0.15
149 0.11
150 0.08
151 0.07
152 0.08
153 0.08
154 0.09
155 0.09
156 0.1
157 0.11
158 0.12
159 0.11
160 0.13
161 0.19
162 0.21
163 0.21
164 0.21
165 0.2
166 0.19
167 0.19
168 0.17
169 0.12
170 0.12
171 0.14
172 0.15
173 0.16
174 0.22
175 0.25
176 0.25
177 0.31
178 0.36
179 0.38
180 0.39
181 0.39
182 0.33
183 0.34
184 0.34
185 0.3
186 0.25
187 0.23
188 0.26
189 0.29
190 0.33
191 0.32
192 0.36
193 0.36
194 0.37
195 0.37
196 0.44
197 0.44
198 0.46
199 0.51
200 0.53
201 0.57
202 0.62
203 0.65
204 0.61
205 0.68
206 0.72
207 0.74
208 0.76
209 0.76
210 0.76
211 0.8
212 0.83
213 0.79
214 0.75
215 0.69
216 0.63
217 0.56
218 0.48
219 0.39
220 0.28
221 0.21
222 0.13
223 0.09
224 0.07
225 0.06
226 0.07
227 0.07
228 0.08
229 0.16
230 0.18
231 0.21
232 0.26
233 0.3
234 0.32
235 0.39
236 0.45
237 0.43
238 0.46
239 0.49
240 0.45
241 0.43
242 0.41
243 0.35
244 0.28
245 0.29
246 0.3
247 0.27
248 0.31
249 0.3
250 0.3
251 0.29
252 0.28
253 0.23
254 0.19
255 0.16
256 0.11
257 0.14
258 0.15
259 0.15
260 0.17
261 0.17
262 0.16