Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QKA7

Protein Details
Accession W1QKA7   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPKKTKKTAGAAKKGKKVTGBasic
312-341QARSIVGRKEKKVNKLKRGKENQNGGDSKRHydrophilic
NLS Segment(s)
PositionSequence
4-18KKTKKTAGAAKKGKK
318-343GRKEKKVNKLKRGKENQNGGDSKRRK
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:0000502  C:proteasome complex  
GO:1990904  C:ribonucleoprotein complex  
KEGG opa:HPODL_00065  -  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MPPKKTKKTAGAAKKGKKVTGTVVNTEPKVQKGVFVKDVAVKKAVSELIKWKESQKPDKPQLFDDDDASLYMQLTSVKFFSKKQVLKPTTVAVPHPVHDLENEFKVCVFVKDGQIDADTLEKIEQENIPHLAKIISASELKGAYKSYEARRKLQKEYDLFLSDESLITALPKLLGKIFYSTSKLPLPIRLKTKENVFSVTTLANQVSKMINSVHYVAPMGVNLTLNLGSVRQPLDNIVDNVQALTQHFEKQPLKTIQLKLLESPGLPIYIAEHIFSEQDVGEEEKPAKDETPEVRLTKFEKGLVELALDEDQARSIVGRKEKKVNKLKRGKENQNGGDSKRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.81
3 0.74
4 0.67
5 0.6
6 0.57
7 0.56
8 0.53
9 0.49
10 0.51
11 0.53
12 0.51
13 0.53
14 0.47
15 0.39
16 0.38
17 0.33
18 0.32
19 0.33
20 0.39
21 0.37
22 0.36
23 0.36
24 0.39
25 0.44
26 0.4
27 0.36
28 0.29
29 0.25
30 0.28
31 0.3
32 0.24
33 0.23
34 0.29
35 0.34
36 0.37
37 0.38
38 0.39
39 0.43
40 0.5
41 0.57
42 0.58
43 0.62
44 0.69
45 0.76
46 0.73
47 0.69
48 0.68
49 0.63
50 0.54
51 0.45
52 0.37
53 0.3
54 0.27
55 0.24
56 0.16
57 0.11
58 0.09
59 0.08
60 0.08
61 0.08
62 0.1
63 0.1
64 0.13
65 0.15
66 0.16
67 0.24
68 0.32
69 0.37
70 0.43
71 0.54
72 0.54
73 0.56
74 0.57
75 0.52
76 0.46
77 0.43
78 0.36
79 0.31
80 0.3
81 0.26
82 0.26
83 0.24
84 0.2
85 0.19
86 0.22
87 0.17
88 0.2
89 0.19
90 0.16
91 0.16
92 0.16
93 0.16
94 0.13
95 0.14
96 0.13
97 0.16
98 0.17
99 0.17
100 0.17
101 0.17
102 0.16
103 0.13
104 0.12
105 0.08
106 0.07
107 0.07
108 0.07
109 0.07
110 0.09
111 0.09
112 0.09
113 0.11
114 0.14
115 0.14
116 0.14
117 0.14
118 0.12
119 0.11
120 0.11
121 0.09
122 0.08
123 0.08
124 0.08
125 0.1
126 0.1
127 0.1
128 0.1
129 0.1
130 0.09
131 0.11
132 0.15
133 0.21
134 0.29
135 0.32
136 0.38
137 0.47
138 0.51
139 0.55
140 0.56
141 0.55
142 0.5
143 0.5
144 0.47
145 0.4
146 0.35
147 0.29
148 0.24
149 0.17
150 0.14
151 0.11
152 0.07
153 0.05
154 0.04
155 0.05
156 0.04
157 0.04
158 0.04
159 0.05
160 0.05
161 0.07
162 0.07
163 0.09
164 0.1
165 0.11
166 0.14
167 0.14
168 0.17
169 0.17
170 0.19
171 0.18
172 0.24
173 0.26
174 0.29
175 0.35
176 0.36
177 0.37
178 0.37
179 0.43
180 0.42
181 0.39
182 0.37
183 0.31
184 0.28
185 0.26
186 0.24
187 0.18
188 0.13
189 0.12
190 0.1
191 0.09
192 0.09
193 0.09
194 0.08
195 0.09
196 0.09
197 0.1
198 0.11
199 0.13
200 0.12
201 0.12
202 0.12
203 0.11
204 0.1
205 0.09
206 0.08
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.08
217 0.09
218 0.08
219 0.09
220 0.1
221 0.13
222 0.15
223 0.15
224 0.15
225 0.15
226 0.15
227 0.14
228 0.13
229 0.11
230 0.09
231 0.11
232 0.11
233 0.14
234 0.15
235 0.22
236 0.25
237 0.26
238 0.34
239 0.34
240 0.38
241 0.41
242 0.43
243 0.43
244 0.46
245 0.45
246 0.37
247 0.36
248 0.33
249 0.26
250 0.25
251 0.19
252 0.13
253 0.12
254 0.11
255 0.1
256 0.12
257 0.12
258 0.11
259 0.1
260 0.11
261 0.11
262 0.11
263 0.1
264 0.07
265 0.07
266 0.08
267 0.11
268 0.1
269 0.13
270 0.14
271 0.14
272 0.16
273 0.17
274 0.17
275 0.15
276 0.21
277 0.22
278 0.27
279 0.32
280 0.32
281 0.32
282 0.35
283 0.37
284 0.38
285 0.36
286 0.33
287 0.28
288 0.3
289 0.31
290 0.27
291 0.25
292 0.18
293 0.17
294 0.15
295 0.14
296 0.11
297 0.09
298 0.09
299 0.08
300 0.08
301 0.07
302 0.11
303 0.18
304 0.27
305 0.35
306 0.4
307 0.51
308 0.58
309 0.68
310 0.74
311 0.79
312 0.8
313 0.83
314 0.87
315 0.88
316 0.91
317 0.91
318 0.9
319 0.9
320 0.86
321 0.85
322 0.81
323 0.74