Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QDH6

Protein Details
Accession W1QDH6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-48VLRLYPAEEKQKKKQRNRVRWEEGVVHydrophilic
98-126GPSKPNAYERQPKYKRKKCAQCEHEHNHGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG opa:HPODL_05194  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MPSETSQPTQTTTQTETVPVRNVLRLYPAEEKQKKKQRNRVRWEEGVVDNEFMNKKKSKICCIFHPNNEDEYEVEETESESESSSSSSSSSDESDHEGPSKPNAYERQPKYKRKKCAQCEHEHNHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.3
5 0.31
6 0.3
7 0.28
8 0.28
9 0.28
10 0.24
11 0.26
12 0.23
13 0.25
14 0.28
15 0.31
16 0.38
17 0.45
18 0.51
19 0.56
20 0.65
21 0.7
22 0.74
23 0.81
24 0.81
25 0.85
26 0.89
27 0.89
28 0.87
29 0.8
30 0.73
31 0.67
32 0.57
33 0.5
34 0.4
35 0.3
36 0.22
37 0.2
38 0.18
39 0.15
40 0.17
41 0.15
42 0.17
43 0.22
44 0.26
45 0.33
46 0.41
47 0.43
48 0.48
49 0.55
50 0.59
51 0.57
52 0.58
53 0.51
54 0.44
55 0.41
56 0.33
57 0.24
58 0.21
59 0.18
60 0.13
61 0.11
62 0.1
63 0.09
64 0.09
65 0.1
66 0.07
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.07
76 0.08
77 0.09
78 0.09
79 0.1
80 0.15
81 0.16
82 0.17
83 0.18
84 0.18
85 0.18
86 0.22
87 0.24
88 0.2
89 0.25
90 0.29
91 0.35
92 0.44
93 0.5
94 0.57
95 0.63
96 0.73
97 0.79
98 0.82
99 0.85
100 0.86
101 0.9
102 0.9
103 0.91
104 0.9
105 0.9
106 0.91