Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5QT59

Protein Details
Accession Q5QT59   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPNRRARKKRRTEDFSSSSAHydrophilic
NLS Segment(s)
PositionSequence
4-11RRARKKRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0042254  P:ribosome biogenesis  
KEGG opa:HPODL_01879  -  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MPNRRARKKRRTEDFSSSSASENDSDSESVTSVQEEQPDAPETYTIDGLDTQEVSDSTQVRLQQLNADRLASIEQSLSGNLKLDINAVRQIDDVREQLQNEYLKKLLVTYSEDLDALRQKTDFKENSLKTLARLLKESGNIFDDGTLKSLVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.68
4 0.58
5 0.49
6 0.41
7 0.34
8 0.25
9 0.2
10 0.18
11 0.15
12 0.14
13 0.13
14 0.13
15 0.12
16 0.12
17 0.11
18 0.1
19 0.1
20 0.11
21 0.12
22 0.12
23 0.12
24 0.14
25 0.16
26 0.16
27 0.14
28 0.14
29 0.13
30 0.13
31 0.13
32 0.11
33 0.08
34 0.08
35 0.09
36 0.09
37 0.08
38 0.06
39 0.06
40 0.07
41 0.07
42 0.09
43 0.09
44 0.09
45 0.11
46 0.12
47 0.13
48 0.14
49 0.14
50 0.17
51 0.2
52 0.22
53 0.21
54 0.2
55 0.18
56 0.17
57 0.18
58 0.12
59 0.09
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.08
72 0.09
73 0.12
74 0.12
75 0.12
76 0.12
77 0.13
78 0.12
79 0.13
80 0.13
81 0.12
82 0.13
83 0.13
84 0.14
85 0.18
86 0.21
87 0.2
88 0.21
89 0.19
90 0.17
91 0.17
92 0.17
93 0.13
94 0.12
95 0.15
96 0.15
97 0.16
98 0.16
99 0.16
100 0.15
101 0.17
102 0.19
103 0.16
104 0.15
105 0.14
106 0.16
107 0.19
108 0.28
109 0.28
110 0.29
111 0.39
112 0.39
113 0.44
114 0.47
115 0.44
116 0.37
117 0.43
118 0.41
119 0.33
120 0.35
121 0.32
122 0.31
123 0.35
124 0.36
125 0.3
126 0.28
127 0.27
128 0.24
129 0.23
130 0.21
131 0.17
132 0.18