Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1QAV2

Protein Details
Accession W1QAV2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
134-155QSYLNVTKRKLHKPGNPKTGAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 14, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000971  Globin  
IPR009050  Globin-like_sf  
IPR012292  Globin/Proto  
IPR044399  Mb-like_M  
Gene Ontology GO:0020037  F:heme binding  
GO:0019825  F:oxygen binding  
KEGG opa:HPODL_03117  -  
Pfam View protein in Pfam  
PF00042  Globin  
PROSITE View protein in PROSITE  
PS01033  GLOBIN  
CDD cd01040  Mb-like  
Amino Acid Sequences MSTLDDLSRMDESLESLGRLHSRILGIEPEYFQTMGEVLIKTFRDRFSNDMADGFSLETEEAWIKLYCFLANSIIQGGIDPIINYEAAKGEQSSLTSSQIKKKQSSTSLDSLSGSTLASNSLPLPKKSQSISKQSYLNVTKRKLHKPGNPKTGAKSSADCIIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.12
4 0.14
5 0.14
6 0.15
7 0.14
8 0.14
9 0.14
10 0.14
11 0.16
12 0.17
13 0.17
14 0.18
15 0.18
16 0.17
17 0.18
18 0.17
19 0.15
20 0.12
21 0.1
22 0.09
23 0.11
24 0.09
25 0.08
26 0.11
27 0.12
28 0.14
29 0.16
30 0.18
31 0.19
32 0.21
33 0.24
34 0.27
35 0.3
36 0.28
37 0.26
38 0.25
39 0.21
40 0.2
41 0.16
42 0.09
43 0.06
44 0.06
45 0.04
46 0.05
47 0.05
48 0.05
49 0.07
50 0.07
51 0.07
52 0.09
53 0.09
54 0.08
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.08
81 0.09
82 0.12
83 0.15
84 0.17
85 0.24
86 0.3
87 0.33
88 0.35
89 0.38
90 0.42
91 0.44
92 0.49
93 0.47
94 0.46
95 0.44
96 0.42
97 0.38
98 0.32
99 0.26
100 0.2
101 0.13
102 0.08
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.14
109 0.17
110 0.18
111 0.23
112 0.25
113 0.29
114 0.32
115 0.4
116 0.41
117 0.48
118 0.52
119 0.52
120 0.53
121 0.51
122 0.57
123 0.54
124 0.55
125 0.53
126 0.52
127 0.56
128 0.6
129 0.68
130 0.69
131 0.71
132 0.72
133 0.75
134 0.81
135 0.83
136 0.83
137 0.77
138 0.75
139 0.73
140 0.67
141 0.6
142 0.52
143 0.44