Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QG19

Protein Details
Accession W1QG19    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-43PDLPTELSRTKRKPKPKVKHEEDAVAHydrophilic
99-122ELDRSGRPCKRWTKKTRVFKTFSGHydrophilic
NLS Segment(s)
PositionSequence
27-36TKRKPKPKVK
57-67KRRIIIKPLKK
Subcellular Location(s) nucl 12, mito 11, cyto_nucl 8.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
KEGG opa:HPODL_05151  -  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MSKLVKLQLSSTALAQFPDLPTELSRTKRKPKPKVKHEEDAVASPVRIEGTDENDKKRRIIIKPLKKPGVPSSPVVEDTPSRAETPTGSKARASGLSGELDRSGRPCKRWTKKTRVFKTFSGWDVEVGIWRPCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.17
4 0.14
5 0.15
6 0.14
7 0.13
8 0.13
9 0.18
10 0.21
11 0.26
12 0.34
13 0.4
14 0.5
15 0.58
16 0.67
17 0.73
18 0.8
19 0.85
20 0.87
21 0.91
22 0.88
23 0.89
24 0.81
25 0.77
26 0.68
27 0.59
28 0.5
29 0.39
30 0.31
31 0.22
32 0.19
33 0.12
34 0.09
35 0.09
36 0.07
37 0.13
38 0.22
39 0.24
40 0.29
41 0.34
42 0.35
43 0.34
44 0.37
45 0.38
46 0.32
47 0.41
48 0.46
49 0.52
50 0.61
51 0.68
52 0.67
53 0.61
54 0.61
55 0.56
56 0.53
57 0.45
58 0.37
59 0.32
60 0.3
61 0.31
62 0.28
63 0.23
64 0.15
65 0.15
66 0.17
67 0.15
68 0.14
69 0.12
70 0.13
71 0.13
72 0.18
73 0.23
74 0.23
75 0.23
76 0.22
77 0.23
78 0.25
79 0.25
80 0.21
81 0.15
82 0.15
83 0.16
84 0.16
85 0.16
86 0.15
87 0.14
88 0.14
89 0.14
90 0.2
91 0.22
92 0.25
93 0.33
94 0.43
95 0.53
96 0.64
97 0.71
98 0.75
99 0.81
100 0.89
101 0.92
102 0.9
103 0.85
104 0.78
105 0.76
106 0.71
107 0.63
108 0.58
109 0.48
110 0.39
111 0.35
112 0.31
113 0.26
114 0.22