Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QAH7

Protein Details
Accession W1QAH7   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
81-102LASARFRIKKKQKEKEMEERFDHydrophilic
NLS Segment(s)
PositionSequence
76-94RRRNTLASARFRIKKKQKE
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG opa:HPODL_01452  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MDPEKKASLLDEFDFSFYPSNNQEQRTDTDLSLFSNNEFRNFDSDEQLTISPQETSLDPQLTTISSQVQNNSLEKRRRNTLASARFRIKKKQKEKEMEERFDQVHRHIDSLKVKIKTLEMENKCLKELLLTPADSKAPSLSSTSNYALLQLIKQHSGDSFKVTTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.15
5 0.17
6 0.18
7 0.25
8 0.28
9 0.3
10 0.32
11 0.34
12 0.37
13 0.38
14 0.38
15 0.3
16 0.28
17 0.26
18 0.25
19 0.24
20 0.2
21 0.16
22 0.2
23 0.21
24 0.21
25 0.22
26 0.21
27 0.22
28 0.25
29 0.25
30 0.23
31 0.23
32 0.21
33 0.21
34 0.2
35 0.16
36 0.14
37 0.13
38 0.09
39 0.09
40 0.09
41 0.08
42 0.1
43 0.13
44 0.14
45 0.13
46 0.13
47 0.13
48 0.13
49 0.12
50 0.1
51 0.1
52 0.11
53 0.13
54 0.13
55 0.15
56 0.17
57 0.18
58 0.22
59 0.26
60 0.3
61 0.34
62 0.36
63 0.39
64 0.4
65 0.41
66 0.42
67 0.45
68 0.49
69 0.51
70 0.52
71 0.52
72 0.55
73 0.55
74 0.59
75 0.59
76 0.59
77 0.63
78 0.69
79 0.73
80 0.77
81 0.82
82 0.83
83 0.83
84 0.76
85 0.68
86 0.61
87 0.52
88 0.45
89 0.38
90 0.29
91 0.27
92 0.23
93 0.23
94 0.21
95 0.25
96 0.27
97 0.33
98 0.37
99 0.32
100 0.32
101 0.32
102 0.32
103 0.3
104 0.32
105 0.36
106 0.32
107 0.38
108 0.42
109 0.42
110 0.41
111 0.38
112 0.31
113 0.24
114 0.24
115 0.22
116 0.2
117 0.2
118 0.21
119 0.22
120 0.24
121 0.21
122 0.19
123 0.15
124 0.13
125 0.13
126 0.15
127 0.15
128 0.16
129 0.21
130 0.22
131 0.23
132 0.22
133 0.22
134 0.21
135 0.2
136 0.19
137 0.2
138 0.21
139 0.21
140 0.21
141 0.21
142 0.22
143 0.26
144 0.26
145 0.26