Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1QFP6

Protein Details
Accession W1QFP6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAAATTKKTARKKKDPNAPKRSLSAHydrophilic
NLS Segment(s)
PositionSequence
7-20KKTARKKKDPNAPK
Subcellular Location(s) nucl 12.5, mito 10.5, cyto_nucl 8.833, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG opa:HPODL_03671  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAATTKKTARKKKDPNAPKRSLSAYMFFANEQRDIVRAENPGIAFGQIGKLLGEKWKALDEAGKAPYEAKAEADKKRYELEKSEYTKSQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.9
3 0.91
4 0.92
5 0.88
6 0.81
7 0.73
8 0.68
9 0.62
10 0.53
11 0.45
12 0.38
13 0.33
14 0.3
15 0.26
16 0.24
17 0.2
18 0.18
19 0.15
20 0.12
21 0.11
22 0.12
23 0.13
24 0.13
25 0.12
26 0.13
27 0.14
28 0.14
29 0.13
30 0.11
31 0.1
32 0.08
33 0.07
34 0.07
35 0.05
36 0.05
37 0.04
38 0.05
39 0.05
40 0.08
41 0.09
42 0.09
43 0.1
44 0.11
45 0.11
46 0.11
47 0.14
48 0.14
49 0.17
50 0.19
51 0.18
52 0.17
53 0.17
54 0.19
55 0.18
56 0.16
57 0.13
58 0.2
59 0.25
60 0.31
61 0.36
62 0.37
63 0.37
64 0.43
65 0.45
66 0.42
67 0.43
68 0.44
69 0.48
70 0.51
71 0.55