Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1Q862

Protein Details
Accession W1Q862   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-69FTENRKRKMPQKKPLDFSRGAHydrophilic
NLS Segment(s)
PositionSequence
54-61KRKMPQKK
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
KEGG opa:HPODL_05376  -  
Amino Acid Sequences MAKSKAKTTIIQLASTAKTGYMRSLVIQRTANERKHIHYDPIVKRHVLFTENRKRKMPQKKPLDFSRGAFDWQKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.24
4 0.15
5 0.15
6 0.14
7 0.14
8 0.12
9 0.12
10 0.12
11 0.18
12 0.19
13 0.21
14 0.23
15 0.22
16 0.29
17 0.35
18 0.36
19 0.36
20 0.37
21 0.36
22 0.4
23 0.41
24 0.35
25 0.33
26 0.4
27 0.39
28 0.44
29 0.42
30 0.36
31 0.35
32 0.34
33 0.31
34 0.24
35 0.23
36 0.28
37 0.37
38 0.45
39 0.49
40 0.51
41 0.54
42 0.61
43 0.68
44 0.68
45 0.67
46 0.7
47 0.75
48 0.8
49 0.83
50 0.82
51 0.74
52 0.65
53 0.63
54 0.53
55 0.48
56 0.48