Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QE08

Protein Details
Accession W1QE08    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
148-172VFYKSRLQQHSKKIRQQQIVQKLNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG opa:HPODL_03572  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MTSPFPNIYQLRRVSSDNAKPCTICYKSTQAVLVSSPDFFYVCESHLKDKQFCTVKYADGEDGKDAEYQSLHEEVRSLDQKATQIQHKIQQRESQLAKVRDYLWKPKDDENQPDLKKQLAEIIKQRDLASAKLEKFIKAYTRYMLDAVFYKSRLQQHSKKIRQQQIVQKLNNGTLFPSIPDLPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.48
3 0.53
4 0.53
5 0.53
6 0.51
7 0.47
8 0.47
9 0.49
10 0.42
11 0.36
12 0.33
13 0.36
14 0.36
15 0.39
16 0.39
17 0.31
18 0.3
19 0.28
20 0.26
21 0.19
22 0.17
23 0.15
24 0.13
25 0.12
26 0.1
27 0.12
28 0.1
29 0.11
30 0.17
31 0.19
32 0.24
33 0.28
34 0.33
35 0.33
36 0.33
37 0.4
38 0.41
39 0.39
40 0.39
41 0.36
42 0.34
43 0.32
44 0.33
45 0.28
46 0.23
47 0.23
48 0.19
49 0.17
50 0.16
51 0.15
52 0.13
53 0.11
54 0.09
55 0.09
56 0.1
57 0.11
58 0.1
59 0.09
60 0.1
61 0.1
62 0.15
63 0.16
64 0.15
65 0.13
66 0.15
67 0.16
68 0.19
69 0.21
70 0.19
71 0.21
72 0.22
73 0.27
74 0.32
75 0.34
76 0.34
77 0.36
78 0.34
79 0.37
80 0.36
81 0.36
82 0.37
83 0.36
84 0.34
85 0.31
86 0.3
87 0.3
88 0.32
89 0.35
90 0.32
91 0.34
92 0.36
93 0.4
94 0.47
95 0.47
96 0.51
97 0.46
98 0.52
99 0.48
100 0.48
101 0.43
102 0.36
103 0.31
104 0.24
105 0.27
106 0.21
107 0.23
108 0.28
109 0.34
110 0.34
111 0.36
112 0.36
113 0.33
114 0.32
115 0.29
116 0.27
117 0.26
118 0.25
119 0.29
120 0.29
121 0.26
122 0.26
123 0.28
124 0.29
125 0.27
126 0.28
127 0.26
128 0.27
129 0.28
130 0.27
131 0.24
132 0.2
133 0.18
134 0.2
135 0.19
136 0.18
137 0.19
138 0.23
139 0.29
140 0.35
141 0.4
142 0.44
143 0.53
144 0.64
145 0.71
146 0.76
147 0.8
148 0.82
149 0.83
150 0.84
151 0.83
152 0.83
153 0.83
154 0.75
155 0.71
156 0.64
157 0.6
158 0.53
159 0.43
160 0.34
161 0.27
162 0.26
163 0.21
164 0.23
165 0.2