Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QKQ5

Protein Details
Accession W1QKQ5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYHRVAENBasic
NLS Segment(s)
PositionSequence
9-26KIVKKHTKKFKRHHSDRY
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG opa:HPODL_00790  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSCVRRRFRGTIREPKIGYGSNKKTRHMMPSGHKAFLVKNVKDLECLIMHTKTYAAEIAHNVSAKNRVEILARAKAIGVKVTNPKGRLSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.9
13 0.85
14 0.74
15 0.69
16 0.69
17 0.68
18 0.68
19 0.67
20 0.6
21 0.55
22 0.54
23 0.58
24 0.53
25 0.5
26 0.48
27 0.49
28 0.55
29 0.64
30 0.68
31 0.61
32 0.58
33 0.56
34 0.55
35 0.56
36 0.56
37 0.57
38 0.59
39 0.64
40 0.61
41 0.56
42 0.51
43 0.44
44 0.39
45 0.37
46 0.4
47 0.43
48 0.45
49 0.45
50 0.46
51 0.45
52 0.46
53 0.41
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.32
62 0.34
63 0.36
64 0.25
65 0.27
66 0.3
67 0.3
68 0.3
69 0.3
70 0.24
71 0.16
72 0.18
73 0.16
74 0.14
75 0.13
76 0.13
77 0.13
78 0.11
79 0.11
80 0.11
81 0.09
82 0.1
83 0.11
84 0.14
85 0.15
86 0.16
87 0.15
88 0.15
89 0.21
90 0.2
91 0.2
92 0.18
93 0.17
94 0.19
95 0.23
96 0.28
97 0.28
98 0.28
99 0.26
100 0.26
101 0.27
102 0.26
103 0.26
104 0.21
105 0.2
106 0.29
107 0.37
108 0.42
109 0.42
110 0.43
111 0.42