Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QCZ1

Protein Details
Accession W1QCZ1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-64ADIIRQRSKARRNKIRRVGYTHydrophilic
NLS Segment(s)
PositionSequence
52-57KARRNK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
KEGG opa:HPODL_04082  -  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSLSARVKNMKFMRMADGTEVKQEEEVQTTPKLTDLSEWKLPVADIIRQRSKARRNKIRRVGYTQVYQMVDLVRVSGRRNNAPEPAEAEAEPDEPKTEPKIGLTALRANSSFVKRKEQDDDDFPMKKRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.35
4 0.36
5 0.31
6 0.32
7 0.31
8 0.25
9 0.23
10 0.23
11 0.19
12 0.17
13 0.18
14 0.16
15 0.16
16 0.17
17 0.16
18 0.16
19 0.16
20 0.12
21 0.16
22 0.18
23 0.22
24 0.25
25 0.25
26 0.24
27 0.24
28 0.23
29 0.21
30 0.18
31 0.17
32 0.19
33 0.25
34 0.29
35 0.31
36 0.35
37 0.4
38 0.48
39 0.53
40 0.58
41 0.62
42 0.68
43 0.76
44 0.83
45 0.84
46 0.8
47 0.78
48 0.73
49 0.66
50 0.59
51 0.49
52 0.42
53 0.33
54 0.28
55 0.21
56 0.16
57 0.13
58 0.1
59 0.09
60 0.06
61 0.07
62 0.09
63 0.12
64 0.14
65 0.18
66 0.22
67 0.24
68 0.28
69 0.28
70 0.28
71 0.28
72 0.27
73 0.24
74 0.2
75 0.19
76 0.15
77 0.15
78 0.14
79 0.11
80 0.1
81 0.1
82 0.12
83 0.13
84 0.15
85 0.14
86 0.15
87 0.17
88 0.17
89 0.2
90 0.21
91 0.24
92 0.23
93 0.25
94 0.24
95 0.24
96 0.28
97 0.32
98 0.37
99 0.34
100 0.42
101 0.43
102 0.48
103 0.54
104 0.55
105 0.54
106 0.52
107 0.57
108 0.54
109 0.56
110 0.54