Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QLL5

Protein Details
Accession W1QLL5   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
172-197RTLSRMERKKLVKKNELQMKRNREKIHydrophilic
NLS Segment(s)
PositionSequence
100-126IPKAKEPTKWELFAAKKGIKKKGKDGK
179-194RKKLVKKNELQMKRNR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG opa:HPODL_02078  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MTSEHQVKPVTVEKPIPVNYDLGNLAVFDPNPLEASKITNDKTKNDYLRDVTRDNVQLLINQVLSLPLKKTSDNSNGQNSTMTLIQLPDPTTQLPREKSIPKAKEPTKWELFAAKKGIKKKGKDGKLVYDERTGKWVNKWGYKGKNKEVESDWLVELDDKNVGTENELIDPRTLSRMERKKLVKKNELQMKRNREKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.37
4 0.32
5 0.32
6 0.28
7 0.28
8 0.25
9 0.19
10 0.16
11 0.13
12 0.13
13 0.12
14 0.12
15 0.09
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.09
22 0.13
23 0.16
24 0.21
25 0.22
26 0.27
27 0.3
28 0.32
29 0.37
30 0.42
31 0.44
32 0.42
33 0.45
34 0.44
35 0.49
36 0.49
37 0.45
38 0.39
39 0.38
40 0.37
41 0.32
42 0.29
43 0.23
44 0.19
45 0.2
46 0.2
47 0.14
48 0.12
49 0.11
50 0.1
51 0.11
52 0.11
53 0.09
54 0.11
55 0.12
56 0.13
57 0.15
58 0.2
59 0.27
60 0.32
61 0.35
62 0.39
63 0.39
64 0.39
65 0.37
66 0.31
67 0.24
68 0.19
69 0.15
70 0.08
71 0.08
72 0.08
73 0.09
74 0.1
75 0.09
76 0.1
77 0.1
78 0.12
79 0.14
80 0.17
81 0.18
82 0.19
83 0.23
84 0.24
85 0.31
86 0.38
87 0.4
88 0.4
89 0.47
90 0.48
91 0.5
92 0.53
93 0.53
94 0.47
95 0.45
96 0.41
97 0.39
98 0.37
99 0.34
100 0.35
101 0.31
102 0.32
103 0.36
104 0.45
105 0.45
106 0.47
107 0.53
108 0.58
109 0.6
110 0.65
111 0.63
112 0.62
113 0.64
114 0.64
115 0.56
116 0.54
117 0.49
118 0.41
119 0.42
120 0.35
121 0.28
122 0.28
123 0.34
124 0.31
125 0.35
126 0.4
127 0.43
128 0.52
129 0.59
130 0.63
131 0.64
132 0.68
133 0.63
134 0.63
135 0.58
136 0.54
137 0.48
138 0.43
139 0.35
140 0.26
141 0.25
142 0.21
143 0.18
144 0.13
145 0.12
146 0.09
147 0.09
148 0.11
149 0.1
150 0.11
151 0.12
152 0.12
153 0.15
154 0.16
155 0.16
156 0.15
157 0.16
158 0.16
159 0.18
160 0.17
161 0.17
162 0.27
163 0.35
164 0.4
165 0.48
166 0.57
167 0.63
168 0.72
169 0.79
170 0.79
171 0.78
172 0.83
173 0.85
174 0.85
175 0.83
176 0.84
177 0.85