Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1Q803

Protein Details
Accession W1Q803    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
187-212LEDFNKKLPKRFAKNGKYMKKRDTPAHydrophilic
NLS Segment(s)
PositionSequence
192-213KKLPKRFAKNGKYMKKRDTPAA
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
KEGG opa:HPODL_02720  -  
Amino Acid Sequences MFMFDKPVASEADTSLEPQVIDLNTFEYRDVSAQAPTARKTRFWFWPFGGNRSAKESIAVSGPETVATKEKQLKKISDSTNKVIAMRKVHDDGVELEDDFIDIQVRKLSYAEVAALQLRKDREPPSDSSRDASLGVPRIDPVVDQDLELEKSITDVEFADSYSKSKKFSIDEFSRTESTLAEEDKILEDFNKKLPKRFAKNGKYMKKRDTPAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.13
5 0.12
6 0.15
7 0.12
8 0.13
9 0.11
10 0.14
11 0.14
12 0.15
13 0.15
14 0.12
15 0.13
16 0.13
17 0.15
18 0.13
19 0.12
20 0.15
21 0.19
22 0.22
23 0.24
24 0.3
25 0.29
26 0.31
27 0.35
28 0.38
29 0.44
30 0.44
31 0.47
32 0.42
33 0.51
34 0.5
35 0.49
36 0.49
37 0.41
38 0.39
39 0.4
40 0.4
41 0.3
42 0.28
43 0.25
44 0.19
45 0.19
46 0.18
47 0.12
48 0.12
49 0.12
50 0.11
51 0.11
52 0.11
53 0.12
54 0.12
55 0.16
56 0.24
57 0.3
58 0.36
59 0.41
60 0.43
61 0.45
62 0.53
63 0.55
64 0.57
65 0.56
66 0.52
67 0.52
68 0.5
69 0.47
70 0.42
71 0.37
72 0.31
73 0.28
74 0.28
75 0.24
76 0.24
77 0.22
78 0.2
79 0.18
80 0.16
81 0.14
82 0.11
83 0.09
84 0.09
85 0.08
86 0.07
87 0.05
88 0.05
89 0.04
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.06
97 0.07
98 0.07
99 0.06
100 0.06
101 0.07
102 0.08
103 0.08
104 0.1
105 0.11
106 0.12
107 0.15
108 0.17
109 0.21
110 0.23
111 0.28
112 0.33
113 0.36
114 0.36
115 0.34
116 0.32
117 0.28
118 0.26
119 0.22
120 0.18
121 0.17
122 0.17
123 0.15
124 0.15
125 0.14
126 0.13
127 0.12
128 0.12
129 0.12
130 0.12
131 0.11
132 0.12
133 0.14
134 0.14
135 0.15
136 0.12
137 0.07
138 0.08
139 0.08
140 0.07
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.1
147 0.1
148 0.12
149 0.17
150 0.18
151 0.19
152 0.2
153 0.25
154 0.26
155 0.31
156 0.39
157 0.4
158 0.44
159 0.45
160 0.48
161 0.45
162 0.41
163 0.37
164 0.27
165 0.23
166 0.22
167 0.19
168 0.15
169 0.14
170 0.15
171 0.16
172 0.16
173 0.13
174 0.12
175 0.14
176 0.15
177 0.22
178 0.31
179 0.32
180 0.39
181 0.49
182 0.57
183 0.64
184 0.73
185 0.76
186 0.76
187 0.85
188 0.88
189 0.89
190 0.89
191 0.87
192 0.86
193 0.84
194 0.8