Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QKE9

Protein Details
Accession W1QKE9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-93TDEFRYMRKQAKKVHRQKLKQNNFLAQLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG opa:HPODL_05086  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFTLGLVRRFSAVRALLQSSVKEGTPLNIQVFKAGKPAVALKDEEYPDWLWTLLDKEAQEAQLKATDEFRYMRKQAKKVHRQKLKQNNFLAQLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.27
5 0.27
6 0.23
7 0.22
8 0.19
9 0.17
10 0.15
11 0.14
12 0.16
13 0.18
14 0.18
15 0.19
16 0.19
17 0.22
18 0.23
19 0.21
20 0.21
21 0.18
22 0.16
23 0.14
24 0.17
25 0.15
26 0.16
27 0.16
28 0.14
29 0.19
30 0.19
31 0.18
32 0.17
33 0.16
34 0.14
35 0.14
36 0.12
37 0.07
38 0.07
39 0.09
40 0.07
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.14
47 0.12
48 0.13
49 0.14
50 0.15
51 0.14
52 0.16
53 0.16
54 0.16
55 0.18
56 0.21
57 0.24
58 0.26
59 0.34
60 0.39
61 0.46
62 0.54
63 0.63
64 0.71
65 0.75
66 0.83
67 0.84
68 0.85
69 0.89
70 0.9
71 0.9
72 0.88
73 0.84
74 0.81
75 0.77