Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1Q836

Protein Details
Accession W1Q836    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
287-314NDSPAKRRKNSSPPTSSPRKKQHTITDFHydrophilic
NLS Segment(s)
PositionSequence
291-300AKRRKNSSPP
305-305R
Subcellular Location(s) nucl 17.5, cyto_nucl 11, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003738  SRAP  
IPR036590  SRAP-like  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
GO:0018142  P:protein-DNA covalent cross-linking  
GO:0006508  P:proteolysis  
KEGG opa:HPODL_03205  -  
Pfam View protein in Pfam  
PF02586  SRAP  
Amino Acid Sequences MCGRYSMSFAPGELPAQFAQQNLNIDRIEDADLWSAKRYNVGPQCIEPVYFFNVEHESTTPLLRYMKWGVTPKWANQKSQKLSTFNARYENIEHSKIWSHCLDHRCVIPIEGYFEWKTDSSKNKQPWFIRRKDHKLMFLAGLYSIASDGKYEYTIITREAPKQLEWLHSRMPVVLEPGTDEFNSWLGLKDSNWDKLSKLLKVHEKEDLEWYKVKKEVGNVKNDGEDLVKPIKQESLQGFFKKEETEPIKSESKVSIKDEEKKDSASQETVTLSHKEPVIKKEEKNINDSPAKRRKNSSPPTSSPRKKQHTITDFLHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.17
4 0.17
5 0.15
6 0.17
7 0.2
8 0.25
9 0.23
10 0.27
11 0.24
12 0.24
13 0.24
14 0.22
15 0.21
16 0.16
17 0.16
18 0.18
19 0.19
20 0.2
21 0.22
22 0.22
23 0.19
24 0.23
25 0.23
26 0.27
27 0.33
28 0.38
29 0.38
30 0.38
31 0.43
32 0.4
33 0.39
34 0.3
35 0.26
36 0.24
37 0.22
38 0.2
39 0.18
40 0.19
41 0.19
42 0.2
43 0.18
44 0.16
45 0.16
46 0.17
47 0.15
48 0.15
49 0.16
50 0.15
51 0.19
52 0.2
53 0.22
54 0.27
55 0.33
56 0.32
57 0.4
58 0.44
59 0.45
60 0.52
61 0.52
62 0.53
63 0.56
64 0.64
65 0.61
66 0.66
67 0.66
68 0.58
69 0.58
70 0.62
71 0.59
72 0.51
73 0.5
74 0.43
75 0.39
76 0.38
77 0.41
78 0.35
79 0.32
80 0.29
81 0.26
82 0.31
83 0.3
84 0.31
85 0.25
86 0.24
87 0.28
88 0.32
89 0.33
90 0.29
91 0.29
92 0.29
93 0.28
94 0.25
95 0.21
96 0.17
97 0.18
98 0.16
99 0.18
100 0.15
101 0.15
102 0.16
103 0.15
104 0.16
105 0.18
106 0.24
107 0.27
108 0.35
109 0.42
110 0.46
111 0.53
112 0.57
113 0.62
114 0.64
115 0.66
116 0.68
117 0.7
118 0.73
119 0.75
120 0.73
121 0.68
122 0.61
123 0.56
124 0.46
125 0.37
126 0.29
127 0.19
128 0.15
129 0.1
130 0.07
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.06
141 0.07
142 0.08
143 0.11
144 0.12
145 0.14
146 0.17
147 0.18
148 0.17
149 0.19
150 0.2
151 0.23
152 0.23
153 0.24
154 0.23
155 0.23
156 0.23
157 0.21
158 0.2
159 0.14
160 0.14
161 0.12
162 0.09
163 0.09
164 0.1
165 0.11
166 0.1
167 0.1
168 0.08
169 0.08
170 0.09
171 0.08
172 0.07
173 0.07
174 0.08
175 0.08
176 0.13
177 0.15
178 0.19
179 0.2
180 0.2
181 0.19
182 0.26
183 0.29
184 0.27
185 0.27
186 0.28
187 0.36
188 0.38
189 0.39
190 0.39
191 0.37
192 0.35
193 0.41
194 0.37
195 0.32
196 0.33
197 0.32
198 0.3
199 0.31
200 0.31
201 0.24
202 0.29
203 0.37
204 0.38
205 0.45
206 0.44
207 0.42
208 0.42
209 0.4
210 0.34
211 0.25
212 0.19
213 0.15
214 0.17
215 0.17
216 0.16
217 0.16
218 0.19
219 0.17
220 0.22
221 0.23
222 0.26
223 0.31
224 0.33
225 0.34
226 0.33
227 0.34
228 0.31
229 0.27
230 0.29
231 0.29
232 0.33
233 0.33
234 0.37
235 0.4
236 0.38
237 0.39
238 0.36
239 0.35
240 0.35
241 0.36
242 0.39
243 0.41
244 0.5
245 0.53
246 0.54
247 0.5
248 0.49
249 0.48
250 0.44
251 0.41
252 0.35
253 0.3
254 0.26
255 0.25
256 0.23
257 0.24
258 0.23
259 0.21
260 0.22
261 0.24
262 0.27
263 0.31
264 0.35
265 0.41
266 0.44
267 0.45
268 0.52
269 0.59
270 0.56
271 0.59
272 0.57
273 0.56
274 0.58
275 0.6
276 0.6
277 0.61
278 0.66
279 0.65
280 0.68
281 0.7
282 0.73
283 0.79
284 0.79
285 0.78
286 0.78
287 0.82
288 0.86
289 0.85
290 0.84
291 0.84
292 0.83
293 0.81
294 0.81
295 0.83
296 0.8
297 0.79