Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1Q8T2

Protein Details
Accession W1Q8T2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66DNPNNKRAFKYKPCRPNPAFTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037353  ASH2  
IPR001870  B30.2/SPRY  
IPR043136  B30.2/SPRY_sf  
IPR013320  ConA-like_dom_sf  
IPR003877  SPRY_dom  
Gene Ontology GO:0048188  C:Set1C/COMPASS complex  
GO:0051568  P:histone H3-K4 methylation  
KEGG opa:HPODL_03055  -  
PROSITE View protein in PROSITE  
PS50188  B302_SPRY  
CDD cd12872  SPRY_Ash2  
Amino Acid Sequences MGQIKVVPRLKPLPYSSQDLQLELRKPILNKQAALESIEFYSNDDNPNNKRAFKYKPCRPNPAFTSMMYSTTDFPPFYCRLSYFDKSPGILVDENLTTATALQGWRSARANAVIREGTWYIEYRLIKSNDGESHVRFGVARREASLEAPVGFDGYGYGFRDKYGQTVHLSKQGSFLENDQFQTGDVVGLLISLPDMKTQRRLASQQVHQQTVGQPDTDIPVNEPVEFDIVRDQIPIKYKNQLYFEQYDYTASKEMEHLLNPVTVFGEKAVRDTVNFEPCKLPNSSITVYKNGKCCGVAFKDLNAFLPPASEQKQGKEVKGKIPETKDDGSLGYYPMISCYNHGIIQLNTTPNIVVPEDLKDAISNREIKLYSERYEERVLEEYVYDLVDEVTNEYLDDIERMSILQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.53
4 0.55
5 0.52
6 0.47
7 0.46
8 0.43
9 0.43
10 0.36
11 0.39
12 0.33
13 0.34
14 0.39
15 0.45
16 0.43
17 0.41
18 0.42
19 0.43
20 0.41
21 0.42
22 0.35
23 0.27
24 0.23
25 0.24
26 0.21
27 0.17
28 0.19
29 0.17
30 0.2
31 0.22
32 0.26
33 0.29
34 0.37
35 0.39
36 0.39
37 0.42
38 0.45
39 0.52
40 0.57
41 0.64
42 0.66
43 0.73
44 0.77
45 0.84
46 0.82
47 0.82
48 0.76
49 0.72
50 0.64
51 0.54
52 0.53
53 0.43
54 0.41
55 0.32
56 0.28
57 0.24
58 0.24
59 0.26
60 0.19
61 0.18
62 0.22
63 0.22
64 0.23
65 0.22
66 0.21
67 0.23
68 0.31
69 0.34
70 0.32
71 0.36
72 0.36
73 0.34
74 0.34
75 0.3
76 0.26
77 0.23
78 0.2
79 0.16
80 0.14
81 0.14
82 0.13
83 0.12
84 0.08
85 0.07
86 0.07
87 0.06
88 0.07
89 0.07
90 0.11
91 0.11
92 0.15
93 0.17
94 0.17
95 0.17
96 0.22
97 0.27
98 0.24
99 0.28
100 0.25
101 0.23
102 0.26
103 0.25
104 0.2
105 0.17
106 0.16
107 0.13
108 0.18
109 0.19
110 0.18
111 0.25
112 0.26
113 0.26
114 0.26
115 0.29
116 0.26
117 0.3
118 0.3
119 0.23
120 0.26
121 0.24
122 0.23
123 0.19
124 0.18
125 0.22
126 0.23
127 0.22
128 0.2
129 0.22
130 0.23
131 0.23
132 0.23
133 0.16
134 0.12
135 0.12
136 0.11
137 0.09
138 0.08
139 0.07
140 0.05
141 0.05
142 0.06
143 0.07
144 0.09
145 0.08
146 0.09
147 0.12
148 0.12
149 0.13
150 0.14
151 0.15
152 0.17
153 0.22
154 0.23
155 0.27
156 0.28
157 0.25
158 0.28
159 0.26
160 0.25
161 0.21
162 0.21
163 0.19
164 0.2
165 0.2
166 0.16
167 0.15
168 0.13
169 0.13
170 0.11
171 0.06
172 0.05
173 0.04
174 0.03
175 0.03
176 0.03
177 0.02
178 0.02
179 0.03
180 0.03
181 0.05
182 0.07
183 0.08
184 0.13
185 0.16
186 0.18
187 0.21
188 0.24
189 0.28
190 0.34
191 0.38
192 0.41
193 0.42
194 0.41
195 0.37
196 0.36
197 0.32
198 0.29
199 0.25
200 0.17
201 0.14
202 0.13
203 0.15
204 0.14
205 0.11
206 0.08
207 0.11
208 0.11
209 0.11
210 0.11
211 0.1
212 0.11
213 0.11
214 0.1
215 0.08
216 0.09
217 0.09
218 0.09
219 0.1
220 0.11
221 0.17
222 0.19
223 0.18
224 0.25
225 0.28
226 0.32
227 0.35
228 0.35
229 0.35
230 0.35
231 0.36
232 0.3
233 0.28
234 0.26
235 0.22
236 0.21
237 0.18
238 0.15
239 0.13
240 0.12
241 0.14
242 0.13
243 0.13
244 0.13
245 0.11
246 0.13
247 0.12
248 0.11
249 0.1
250 0.08
251 0.08
252 0.08
253 0.11
254 0.1
255 0.11
256 0.13
257 0.12
258 0.13
259 0.17
260 0.21
261 0.26
262 0.26
263 0.26
264 0.28
265 0.28
266 0.32
267 0.29
268 0.26
269 0.2
270 0.26
271 0.27
272 0.29
273 0.31
274 0.35
275 0.38
276 0.41
277 0.42
278 0.38
279 0.37
280 0.31
281 0.3
282 0.3
283 0.29
284 0.32
285 0.28
286 0.29
287 0.32
288 0.32
289 0.31
290 0.26
291 0.22
292 0.15
293 0.15
294 0.14
295 0.14
296 0.17
297 0.23
298 0.23
299 0.25
300 0.34
301 0.36
302 0.4
303 0.44
304 0.45
305 0.46
306 0.54
307 0.55
308 0.54
309 0.55
310 0.56
311 0.53
312 0.51
313 0.45
314 0.37
315 0.33
316 0.28
317 0.25
318 0.2
319 0.15
320 0.13
321 0.12
322 0.12
323 0.14
324 0.12
325 0.12
326 0.16
327 0.17
328 0.18
329 0.19
330 0.2
331 0.18
332 0.23
333 0.26
334 0.23
335 0.21
336 0.21
337 0.19
338 0.17
339 0.2
340 0.15
341 0.12
342 0.11
343 0.14
344 0.16
345 0.17
346 0.16
347 0.15
348 0.17
349 0.19
350 0.24
351 0.24
352 0.22
353 0.28
354 0.28
355 0.29
356 0.37
357 0.38
358 0.36
359 0.4
360 0.41
361 0.4
362 0.45
363 0.43
364 0.38
365 0.36
366 0.34
367 0.27
368 0.25
369 0.21
370 0.17
371 0.16
372 0.12
373 0.09
374 0.08
375 0.08
376 0.08
377 0.09
378 0.09
379 0.09
380 0.09
381 0.09
382 0.09
383 0.09
384 0.09
385 0.08
386 0.08
387 0.08