Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W1Q8N8

Protein Details
Accession W1Q8N8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-46QGNLKLSKKKPARVTKLQKNPKAAAPKIHKPKKVNRNEKNLFKLHydrophilic
NLS Segment(s)
PositionSequence
8-39LSKKKPARVTKLQKNPKAAAPKIHKPKKVNRN
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG opa:HPODL_03046  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGNLKLSKKKPARVTKLQKNPKAAAPKIHKPKKVNRNEKNLFKLSQKHTANLVSSTEKLIASRVGHLELIKGTRRETEKKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.84
4 0.84
5 0.88
6 0.9
7 0.85
8 0.81
9 0.75
10 0.71
11 0.69
12 0.6
13 0.59
14 0.56
15 0.6
16 0.64
17 0.69
18 0.68
19 0.66
20 0.73
21 0.74
22 0.78
23 0.79
24 0.76
25 0.79
26 0.8
27 0.81
28 0.77
29 0.69
30 0.61
31 0.53
32 0.53
33 0.46
34 0.48
35 0.42
36 0.38
37 0.37
38 0.37
39 0.35
40 0.28
41 0.27
42 0.19
43 0.19
44 0.18
45 0.17
46 0.15
47 0.13
48 0.13
49 0.14
50 0.13
51 0.15
52 0.16
53 0.16
54 0.17
55 0.17
56 0.17
57 0.16
58 0.2
59 0.22
60 0.22
61 0.22
62 0.28
63 0.34
64 0.4