Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QLQ2

Protein Details
Accession W1QLQ2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
243-263PEDGRKEEGLRRRRRSAKELKBasic
NLS Segment(s)
PositionSequence
247-263RKEEGLRRRRRSAKELK
Subcellular Location(s) cysk 21, cyto 5
Family & Domain DBs
KEGG opa:HPODL_02253  -  
Amino Acid Sequences MSTYPPREELPPLGALCLDYTDDIHRPPGDPLNELSYQFPVIHEMVKDATVWNVVRKDEYSDETLQNYIDACNRLQQRGAVGVITSCGFLAQVQNRLAAAVEIPVATSSLIQLPFVSMVIGPSKLIGVLTFDAEVLGKAHFKGLGIGEELQSRIVVKGCPVGGVLRGMIIEGDPYIHDDLEKEMVSIAKELVGDNPSIGAIVLECTQMPPFARAVQKATGLPVYDAITMIDWFYSGLVTRIVPEDGRKEEGLRRRRRSAKELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.19
4 0.17
5 0.14
6 0.09
7 0.1
8 0.13
9 0.15
10 0.16
11 0.19
12 0.19
13 0.2
14 0.23
15 0.29
16 0.27
17 0.27
18 0.28
19 0.3
20 0.31
21 0.3
22 0.28
23 0.22
24 0.22
25 0.2
26 0.18
27 0.16
28 0.15
29 0.16
30 0.14
31 0.14
32 0.14
33 0.14
34 0.14
35 0.11
36 0.11
37 0.13
38 0.13
39 0.17
40 0.18
41 0.19
42 0.2
43 0.21
44 0.24
45 0.24
46 0.26
47 0.26
48 0.27
49 0.28
50 0.27
51 0.27
52 0.22
53 0.19
54 0.16
55 0.13
56 0.12
57 0.13
58 0.12
59 0.18
60 0.2
61 0.21
62 0.21
63 0.21
64 0.2
65 0.21
66 0.21
67 0.14
68 0.12
69 0.11
70 0.11
71 0.1
72 0.08
73 0.05
74 0.05
75 0.05
76 0.05
77 0.1
78 0.11
79 0.16
80 0.17
81 0.17
82 0.17
83 0.17
84 0.17
85 0.12
86 0.1
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.06
97 0.07
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.06
104 0.04
105 0.04
106 0.05
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.07
130 0.07
131 0.07
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1
137 0.08
138 0.08
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.09
145 0.09
146 0.1
147 0.1
148 0.09
149 0.09
150 0.1
151 0.09
152 0.06
153 0.06
154 0.06
155 0.05
156 0.05
157 0.04
158 0.03
159 0.04
160 0.03
161 0.06
162 0.06
163 0.06
164 0.06
165 0.07
166 0.08
167 0.11
168 0.11
169 0.09
170 0.09
171 0.1
172 0.1
173 0.11
174 0.09
175 0.08
176 0.08
177 0.08
178 0.1
179 0.1
180 0.1
181 0.09
182 0.09
183 0.08
184 0.07
185 0.07
186 0.05
187 0.04
188 0.05
189 0.06
190 0.06
191 0.06
192 0.07
193 0.07
194 0.09
195 0.1
196 0.1
197 0.11
198 0.16
199 0.2
200 0.22
201 0.25
202 0.26
203 0.28
204 0.27
205 0.28
206 0.26
207 0.22
208 0.21
209 0.19
210 0.18
211 0.15
212 0.15
213 0.13
214 0.11
215 0.11
216 0.1
217 0.08
218 0.06
219 0.06
220 0.06
221 0.06
222 0.05
223 0.06
224 0.07
225 0.08
226 0.09
227 0.11
228 0.13
229 0.13
230 0.17
231 0.22
232 0.25
233 0.29
234 0.29
235 0.3
236 0.37
237 0.45
238 0.51
239 0.56
240 0.6
241 0.67
242 0.75
243 0.8