Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W1QEJ0

Protein Details
Accession W1QEJ0   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-51VLPTRPRKKIRVGKARPAIYHHydrophilic
NLS Segment(s)
PositionSequence
34-46TRPRKKIRVGKAR
170-184LGGKVARKEKGSKKR
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG opa:HPODL_03296  -  
Amino Acid Sequences MLPLAGPCKVVNQMLQTRSYAVLGRPKIASVLPTRPRKKIRVGKARPAIYHKFDTLVELSDGSVITRRTQIPKEEARMIVDQRTNPLWNPSKPDMSQLDAENNGRMSKFKSRFSQFEHSGKTEEEVKAEQETLEKERRERILSGTGVKLDETLADDYVSVLGESYVAPKLGGKVARKEKGSKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.33
4 0.32
5 0.31
6 0.3
7 0.24
8 0.21
9 0.27
10 0.26
11 0.28
12 0.27
13 0.26
14 0.26
15 0.25
16 0.25
17 0.22
18 0.3
19 0.36
20 0.46
21 0.5
22 0.57
23 0.64
24 0.66
25 0.71
26 0.71
27 0.73
28 0.74
29 0.78
30 0.79
31 0.81
32 0.8
33 0.73
34 0.71
35 0.66
36 0.6
37 0.55
38 0.45
39 0.38
40 0.33
41 0.31
42 0.25
43 0.2
44 0.15
45 0.12
46 0.11
47 0.1
48 0.1
49 0.07
50 0.09
51 0.08
52 0.09
53 0.12
54 0.14
55 0.18
56 0.21
57 0.25
58 0.29
59 0.34
60 0.37
61 0.37
62 0.36
63 0.34
64 0.34
65 0.31
66 0.28
67 0.25
68 0.21
69 0.2
70 0.21
71 0.19
72 0.17
73 0.23
74 0.23
75 0.23
76 0.29
77 0.29
78 0.31
79 0.3
80 0.34
81 0.29
82 0.26
83 0.27
84 0.21
85 0.21
86 0.19
87 0.19
88 0.15
89 0.14
90 0.12
91 0.1
92 0.1
93 0.12
94 0.2
95 0.24
96 0.28
97 0.35
98 0.4
99 0.44
100 0.5
101 0.56
102 0.52
103 0.53
104 0.52
105 0.46
106 0.43
107 0.39
108 0.34
109 0.3
110 0.25
111 0.21
112 0.17
113 0.17
114 0.17
115 0.17
116 0.15
117 0.12
118 0.14
119 0.17
120 0.23
121 0.23
122 0.24
123 0.3
124 0.33
125 0.34
126 0.33
127 0.32
128 0.33
129 0.34
130 0.36
131 0.31
132 0.29
133 0.26
134 0.25
135 0.21
136 0.14
137 0.12
138 0.11
139 0.11
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.09
146 0.06
147 0.05
148 0.04
149 0.05
150 0.05
151 0.07
152 0.08
153 0.08
154 0.08
155 0.09
156 0.12
157 0.17
158 0.23
159 0.26
160 0.34
161 0.44
162 0.51
163 0.55
164 0.62