Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DY23

Protein Details
Accession C5DY23    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
206-227DEDQGKRSKKRVKQHEVDYFHVBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
KEGG zro:ZYRO0F09658g  -  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MLETIKLSELTKKRRASEDDTGSEIDISSTDSEGDEEQVNDEEVVNIDFDFFGGNPQVDFHAIKNLLRQILGNEESNKVQLSQLSDLILASPTTTIKTDGPESDPYCFLSFVDYKENRDSDYARYLRRDERMASFLRTVESNSKKSCALLLGERLINMPTEVVPPLYKITLEDVTNALGDGKHYDFYVILSRKYEVNFDMDSDSEDEDQGKRSKKRVKQHEVDYFHVEDRIFEKNAKLHFDLQPHKGLIPTYIVLSHQDLLKSISELEHELQSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.66
4 0.68
5 0.68
6 0.62
7 0.6
8 0.55
9 0.47
10 0.4
11 0.32
12 0.22
13 0.13
14 0.11
15 0.09
16 0.08
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.11
23 0.1
24 0.11
25 0.12
26 0.12
27 0.11
28 0.11
29 0.09
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.07
40 0.08
41 0.08
42 0.08
43 0.09
44 0.1
45 0.11
46 0.12
47 0.11
48 0.17
49 0.18
50 0.19
51 0.23
52 0.25
53 0.24
54 0.23
55 0.23
56 0.17
57 0.22
58 0.23
59 0.22
60 0.2
61 0.21
62 0.22
63 0.22
64 0.21
65 0.15
66 0.14
67 0.13
68 0.14
69 0.14
70 0.15
71 0.14
72 0.14
73 0.13
74 0.13
75 0.11
76 0.08
77 0.06
78 0.06
79 0.05
80 0.06
81 0.07
82 0.09
83 0.09
84 0.11
85 0.13
86 0.14
87 0.17
88 0.22
89 0.22
90 0.22
91 0.22
92 0.22
93 0.2
94 0.19
95 0.15
96 0.14
97 0.14
98 0.14
99 0.22
100 0.21
101 0.23
102 0.27
103 0.27
104 0.24
105 0.25
106 0.25
107 0.19
108 0.26
109 0.27
110 0.25
111 0.27
112 0.29
113 0.31
114 0.33
115 0.32
116 0.26
117 0.26
118 0.28
119 0.27
120 0.26
121 0.23
122 0.2
123 0.18
124 0.16
125 0.15
126 0.19
127 0.22
128 0.23
129 0.23
130 0.25
131 0.24
132 0.24
133 0.23
134 0.17
135 0.14
136 0.13
137 0.14
138 0.15
139 0.15
140 0.15
141 0.14
142 0.13
143 0.11
144 0.09
145 0.07
146 0.05
147 0.06
148 0.06
149 0.07
150 0.06
151 0.07
152 0.08
153 0.08
154 0.08
155 0.07
156 0.1
157 0.12
158 0.12
159 0.13
160 0.12
161 0.12
162 0.12
163 0.12
164 0.09
165 0.06
166 0.06
167 0.08
168 0.08
169 0.08
170 0.08
171 0.09
172 0.08
173 0.1
174 0.18
175 0.17
176 0.17
177 0.18
178 0.19
179 0.21
180 0.22
181 0.22
182 0.15
183 0.17
184 0.17
185 0.17
186 0.17
187 0.15
188 0.16
189 0.15
190 0.15
191 0.11
192 0.11
193 0.11
194 0.11
195 0.15
196 0.19
197 0.25
198 0.28
199 0.37
200 0.46
201 0.53
202 0.63
203 0.7
204 0.75
205 0.76
206 0.82
207 0.84
208 0.8
209 0.77
210 0.71
211 0.62
212 0.52
213 0.45
214 0.35
215 0.26
216 0.23
217 0.23
218 0.2
219 0.19
220 0.22
221 0.24
222 0.28
223 0.32
224 0.33
225 0.33
226 0.37
227 0.44
228 0.47
229 0.46
230 0.49
231 0.44
232 0.42
233 0.38
234 0.34
235 0.27
236 0.24
237 0.21
238 0.16
239 0.16
240 0.17
241 0.18
242 0.2
243 0.2
244 0.18
245 0.18
246 0.17
247 0.19
248 0.2
249 0.18
250 0.16
251 0.15
252 0.15
253 0.18
254 0.19