Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DU11

Protein Details
Accession C5DU11    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-59ATVLRRKDKENKKIETKMRKLEEBasic
229-253CNEISDTKFLRKKKNPKKKMLELEFHydrophilic
NLS Segment(s)
PositionSequence
239-247RKKKNPKKK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
KEGG zro:ZYRO0C12892g  -  
Amino Acid Sequences MVRKNLNKAKLSGKPSQQEVFQAKINHDELTEIMKAATVLRRKDKENKKIETKMRKLEEDLKNPRFAMMMQRLFPMANLTVDQIDRRAPLKTLQKLCMGFEKSLKEQRKSPVKSMDKIGRETELLHTLKTLLKNKTDNIKLKAENRLLREKRETLLSNKKYSNITALKKLRLTKLKEELEETDQQVNSILDQNAKLFKDVENLYQDKQRQLKFERGKRELWSYLRHRYCNEISDTKFLRKKKNPKKKMLELEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.61
4 0.54
5 0.54
6 0.51
7 0.46
8 0.43
9 0.39
10 0.35
11 0.38
12 0.38
13 0.3
14 0.26
15 0.23
16 0.19
17 0.21
18 0.2
19 0.14
20 0.12
21 0.12
22 0.12
23 0.13
24 0.18
25 0.2
26 0.25
27 0.34
28 0.38
29 0.44
30 0.54
31 0.62
32 0.67
33 0.71
34 0.73
35 0.74
36 0.79
37 0.84
38 0.84
39 0.82
40 0.81
41 0.77
42 0.7
43 0.66
44 0.66
45 0.65
46 0.65
47 0.67
48 0.61
49 0.58
50 0.55
51 0.51
52 0.41
53 0.33
54 0.32
55 0.31
56 0.31
57 0.29
58 0.29
59 0.3
60 0.29
61 0.28
62 0.22
63 0.13
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.11
73 0.11
74 0.12
75 0.11
76 0.18
77 0.26
78 0.33
79 0.37
80 0.38
81 0.42
82 0.42
83 0.42
84 0.43
85 0.37
86 0.29
87 0.28
88 0.29
89 0.28
90 0.36
91 0.39
92 0.35
93 0.37
94 0.44
95 0.51
96 0.51
97 0.53
98 0.55
99 0.54
100 0.55
101 0.56
102 0.55
103 0.47
104 0.46
105 0.42
106 0.32
107 0.28
108 0.26
109 0.22
110 0.21
111 0.18
112 0.16
113 0.15
114 0.15
115 0.17
116 0.2
117 0.25
118 0.21
119 0.24
120 0.27
121 0.29
122 0.36
123 0.41
124 0.42
125 0.4
126 0.43
127 0.43
128 0.44
129 0.49
130 0.48
131 0.45
132 0.43
133 0.5
134 0.46
135 0.47
136 0.48
137 0.43
138 0.38
139 0.39
140 0.38
141 0.35
142 0.44
143 0.44
144 0.44
145 0.43
146 0.45
147 0.41
148 0.39
149 0.39
150 0.36
151 0.35
152 0.38
153 0.42
154 0.43
155 0.46
156 0.49
157 0.48
158 0.49
159 0.51
160 0.5
161 0.55
162 0.56
163 0.53
164 0.52
165 0.48
166 0.45
167 0.43
168 0.37
169 0.31
170 0.27
171 0.26
172 0.24
173 0.2
174 0.16
175 0.17
176 0.16
177 0.13
178 0.14
179 0.16
180 0.19
181 0.19
182 0.19
183 0.16
184 0.16
185 0.21
186 0.22
187 0.25
188 0.27
189 0.29
190 0.3
191 0.35
192 0.37
193 0.37
194 0.43
195 0.42
196 0.43
197 0.45
198 0.54
199 0.58
200 0.64
201 0.67
202 0.64
203 0.65
204 0.63
205 0.65
206 0.61
207 0.56
208 0.58
209 0.54
210 0.6
211 0.63
212 0.62
213 0.57
214 0.58
215 0.57
216 0.54
217 0.54
218 0.51
219 0.47
220 0.52
221 0.54
222 0.56
223 0.58
224 0.58
225 0.62
226 0.65
227 0.73
228 0.76
229 0.83
230 0.85
231 0.9
232 0.94
233 0.93