Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E4U1

Protein Details
Accession C5E4U1   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MDPYALKQDNRKRFKDKQHAKQRHATPSDHydrophilic
NLS Segment(s)
PositionSequence
12-24KRFKDKQHAKQRH
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR035303  DUF5364  
KEGG zro:ZYRO0E08756g  -  
Pfam View protein in Pfam  
PF17322  DUF5364  
Amino Acid Sequences MDPYALKQDNRKRFKDKQHAKQRHATPSDRKYRALKRQEQAHEDEQEAPPPPPSNEYRYHEDVTMAYGEQQDEERNTHANKRVRELLMNKDEGSGLNLDQGGLSKESQAAVTRKELEKMDVAGLNRVLGRSHTPDLVKHTNDPLAPPRQATKSQEKARKEPSPNKNVSTVPQDLKDDEDFLDGLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.84
4 0.84
5 0.88
6 0.9
7 0.88
8 0.88
9 0.85
10 0.84
11 0.8
12 0.77
13 0.75
14 0.75
15 0.79
16 0.72
17 0.69
18 0.67
19 0.71
20 0.73
21 0.73
22 0.73
23 0.7
24 0.76
25 0.79
26 0.75
27 0.71
28 0.67
29 0.58
30 0.5
31 0.46
32 0.37
33 0.33
34 0.29
35 0.23
36 0.2
37 0.19
38 0.18
39 0.19
40 0.22
41 0.24
42 0.3
43 0.35
44 0.4
45 0.42
46 0.43
47 0.39
48 0.36
49 0.31
50 0.25
51 0.21
52 0.14
53 0.1
54 0.09
55 0.09
56 0.08
57 0.09
58 0.09
59 0.09
60 0.1
61 0.11
62 0.13
63 0.14
64 0.18
65 0.26
66 0.3
67 0.3
68 0.33
69 0.38
70 0.36
71 0.39
72 0.38
73 0.38
74 0.37
75 0.37
76 0.32
77 0.27
78 0.26
79 0.21
80 0.19
81 0.11
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.11
96 0.12
97 0.13
98 0.15
99 0.19
100 0.19
101 0.22
102 0.22
103 0.2
104 0.2
105 0.19
106 0.18
107 0.17
108 0.17
109 0.16
110 0.15
111 0.14
112 0.13
113 0.12
114 0.1
115 0.09
116 0.12
117 0.15
118 0.17
119 0.2
120 0.2
121 0.22
122 0.3
123 0.35
124 0.33
125 0.31
126 0.32
127 0.32
128 0.31
129 0.33
130 0.32
131 0.31
132 0.3
133 0.3
134 0.32
135 0.33
136 0.39
137 0.42
138 0.46
139 0.5
140 0.58
141 0.65
142 0.66
143 0.7
144 0.73
145 0.76
146 0.76
147 0.76
148 0.77
149 0.79
150 0.78
151 0.73
152 0.69
153 0.62
154 0.57
155 0.53
156 0.5
157 0.43
158 0.41
159 0.41
160 0.37
161 0.39
162 0.36
163 0.3
164 0.25
165 0.23