Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5E4S7

Protein Details
Accession C5E4S7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
107-149GIKNQEKKISKERRSRNKQTKEKKNGKVEKKKFQPPPGLRKRVBasic
NLS Segment(s)
PositionSequence
106-149DGIKNQEKKISKERRSRNKQTKEKKNGKVEKKKFQPPPGLRKRV
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, mito_nucl 12.166, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0032991  C:protein-containing complex  
GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
KEGG zro:ZYRO0E08448g  -  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MSKVQVKQDARLPDLIGFRLRVLTQDGRVYVGELLAFDKFMNLVLKNCIEERIPKTQLDKLQNETSDKNDIKVEKRTLGLAILRGEQVLSSVVQDKPQLSKRERLDGIKNQEKKISKERRSRNKQTKEKKNGKVEKKKFQPPPGLRKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.29
4 0.24
5 0.22
6 0.21
7 0.2
8 0.17
9 0.2
10 0.21
11 0.22
12 0.25
13 0.25
14 0.24
15 0.24
16 0.24
17 0.18
18 0.15
19 0.12
20 0.08
21 0.09
22 0.07
23 0.07
24 0.06
25 0.06
26 0.06
27 0.07
28 0.09
29 0.09
30 0.11
31 0.13
32 0.14
33 0.15
34 0.16
35 0.16
36 0.14
37 0.19
38 0.22
39 0.27
40 0.28
41 0.28
42 0.31
43 0.34
44 0.4
45 0.41
46 0.4
47 0.37
48 0.39
49 0.4
50 0.4
51 0.36
52 0.31
53 0.32
54 0.29
55 0.25
56 0.23
57 0.24
58 0.24
59 0.29
60 0.29
61 0.23
62 0.24
63 0.23
64 0.2
65 0.19
66 0.17
67 0.13
68 0.12
69 0.11
70 0.11
71 0.1
72 0.1
73 0.08
74 0.08
75 0.06
76 0.05
77 0.05
78 0.08
79 0.08
80 0.1
81 0.11
82 0.12
83 0.17
84 0.23
85 0.3
86 0.3
87 0.38
88 0.4
89 0.48
90 0.5
91 0.49
92 0.51
93 0.52
94 0.59
95 0.6
96 0.62
97 0.55
98 0.58
99 0.57
100 0.55
101 0.57
102 0.59
103 0.59
104 0.65
105 0.74
106 0.78
107 0.85
108 0.9
109 0.9
110 0.91
111 0.92
112 0.93
113 0.93
114 0.93
115 0.93
116 0.92
117 0.92
118 0.91
119 0.92
120 0.92
121 0.9
122 0.9
123 0.89
124 0.9
125 0.88
126 0.87
127 0.87
128 0.85
129 0.87