Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DZ92

Protein Details
Accession C5DZ92    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-29LDKLVDEKKYRRRDLRNSLASRIHydrophilic
115-141EIFEQERRPDRRRRTQRDNRRGNGRGSBasic
NLS Segment(s)
PositionSequence
121-145RRPDRRRRTQRDNRRGNGRGSRGSH
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR034396  Yra2_RRM  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0003723  F:RNA binding  
GO:0051028  P:mRNA transport  
KEGG zro:ZYRO0G02442g  -  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
CDD cd12295  RRM_YRA2  
Amino Acid Sequences MSVDNVLDKLVDEKKYRRRDLRNSLASRIGIEDRPSSTPREPPKKRLRFTNVPLDVSDFTLEDMVKEFAEPIYCNFYDLKDSRTAVFEFEDPSVMERVVEKYNETPLNGGTVTVEIFEQERRPDRRRRTQRDNRRGNGRGSRGSHYKRQDRPAMEDELNAELEDYMKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.55
3 0.64
4 0.69
5 0.74
6 0.79
7 0.84
8 0.87
9 0.87
10 0.81
11 0.76
12 0.71
13 0.61
14 0.51
15 0.43
16 0.35
17 0.27
18 0.25
19 0.23
20 0.22
21 0.25
22 0.26
23 0.28
24 0.27
25 0.33
26 0.41
27 0.5
28 0.52
29 0.59
30 0.69
31 0.74
32 0.75
33 0.78
34 0.77
35 0.75
36 0.75
37 0.76
38 0.69
39 0.6
40 0.56
41 0.49
42 0.4
43 0.31
44 0.26
45 0.15
46 0.11
47 0.11
48 0.1
49 0.07
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.08
58 0.07
59 0.12
60 0.12
61 0.13
62 0.13
63 0.13
64 0.17
65 0.18
66 0.19
67 0.16
68 0.17
69 0.17
70 0.19
71 0.19
72 0.14
73 0.14
74 0.12
75 0.11
76 0.1
77 0.11
78 0.08
79 0.09
80 0.09
81 0.08
82 0.08
83 0.07
84 0.09
85 0.1
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.16
93 0.14
94 0.16
95 0.14
96 0.13
97 0.08
98 0.07
99 0.07
100 0.06
101 0.06
102 0.05
103 0.06
104 0.07
105 0.09
106 0.12
107 0.2
108 0.26
109 0.33
110 0.42
111 0.52
112 0.62
113 0.71
114 0.77
115 0.81
116 0.86
117 0.91
118 0.93
119 0.93
120 0.89
121 0.88
122 0.83
123 0.79
124 0.77
125 0.72
126 0.69
127 0.62
128 0.61
129 0.61
130 0.62
131 0.63
132 0.64
133 0.67
134 0.67
135 0.72
136 0.74
137 0.69
138 0.71
139 0.67
140 0.64
141 0.55
142 0.48
143 0.41
144 0.35
145 0.31
146 0.23
147 0.19
148 0.12
149 0.12